PIAS1 monoclonal antibody (M06), clone 4A4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PIAS1.
Immunogen
PIAS1 (NP_057250, 543 a.a. ~ 651 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTSLPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRSSTDTASIFGIIPDIISLD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PIAS1 is approximately 0.03ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between TP53 and PIAS1. HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-PIAS1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — PIAS1
Entrez GeneID
8554GeneBank Accession#
NM_016166Protein Accession#
NP_057250Gene Name
PIAS1
Gene Alias
DDXBP1, GBP, GU/RH-II, MGC141878, MGC141879, ZMIZ3
Gene Description
protein inhibitor of activated STAT, 1
Omim ID
603566Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the mammalian PIAS [protein inhibitor of activated STAT-1 (signal transducer and activator of transcription-1)] family. This member contains a putative zinc-binding motif and a highly acidic region. It inhibits STAT1-mediated gene activation and the DNA binding activity, binds to Gu protein/RNA helicase II/DEAD box polypeptide 21, and interacts with androgen receptor (AR). It functions in testis as a nuclear receptor transcriptional coregulator and may have a role in AR initiation and maintenance of spermatogenesis. [provided by RefSeq
Other Designations
AR interacting protein|DEAD/H (Asp-Glu-Ala-Asp/His) box binding protein 1|protein inhibitor of activated STAT-1|zinc finger, MIZ-type containing 3
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com