Product Browser

Last updated: 2014/4/14
  • Related Product Showcase

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

HIST1H3D monoclonal antibody (M01), clone 1D8

  • Catalog # : H00008351-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant HIST1H3D.
  • Immunogen:
  • HIST1H3D (NP_003521, 1 a.a. ~ 60 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse
  • Isotype:
  • IgG3 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008351-M01
    Western Blot detection against Immunogen (32.34 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • HIST1H3D monoclonal antibody (M01), clone 1D8 Western Blot analysis of HIST1H3D expression in Hela S3 NE ( Cat # L013V3 ).
  • Protocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • HIST1H3D monoclonal antibody (M01), clone 1D8. Western Blot analysis of HIST1H3D expression in Raw 264.7 ( Cat # L024V1 ).
  • Protocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • HIST1H3D monoclonal antibody (M01), clone 1D8. Western Blot analysis of HIST1H3D expression in NIH/3T3 ( Cat # L018V1 ).
  • Protocol Download
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) enlargeenlarge this image
  • Immunoperoxidase of monoclonal antibody to HIST1H3D on formalin-fixed paraffin-embedded human lateral ventricle wall. [antibody concentration 3 ug/ml]
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8351
  • Gene Name:
  • HIST1H3D
  • Gene Alias:
  • H3/b,H3FB
  • Gene Description:
  • histone cluster 1, H3d
  • Gene Summary:
  • Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H3 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6. [provided by RefSeq
  • Other Designations:
  • H3 histone family, member B,OTTHUMP00000016149,histone 1, H3d
  • RSS
  • YouTube
  • Linkedin
  • Facebook