HIST1H3D monoclonal antibody (M01), clone 1D8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HIST1H3D.
Immunogen
HIST1H3D (NP_003521, 1 a.a. ~ 60 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Rat (97)
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (32.34 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
HIST1H3D monoclonal antibody (M01), clone 1D8. Western Blot analysis of HIST1H3D expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
HIST1H3D monoclonal antibody (M01), clone 1D8. Western Blot analysis of HIST1H3D expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
HIST1H3D monoclonal antibody (M01), clone 1D8 Western Blot analysis of HIST1H3D expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to HIST1H3D on formalin-fixed paraffin-embedded human lateral ventricle wall. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HIST1H3D is 0.3 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to HIST1H3D on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — HIST1H3D
Entrez GeneID
8351GeneBank Accession#
NM_003530Protein Accession#
NP_003521Gene Name
HIST1H3D
Gene Alias
H3/b, H3FB
Gene Description
histone cluster 1, H3d
Omim ID
602811Gene Ontology
HyperlinkGene Summary
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H3 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6. [provided by RefSeq
Other Designations
H3 histone family, member B|OTTHUMP00000016149|histone 1, H3d
-
Interactome
-
Pathway
-
Publication Reference
-
Protective effect of caffeic acid on paclitaxel induced anti-proliferation and apoptosis of lung cancer cells involves NF-κB pathway.
Lin CL, Chen RF, Chen JY, Chu YC, Wang HM, Chou HL, Chang WC, Fong Y, Chang WT, Wu CY, Chiu CC.
International Journal of Molecular Sciences 2012 May; 13(5):6236.
Application:WB, Human, A-549 cells.
-
Protective effect of caffeic acid on paclitaxel induced anti-proliferation and apoptosis of lung cancer cells involves NF-κB pathway.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com