Product Browser

Last updated: 2014/4/14
  • Related Product Showcase

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

TARBP2 monoclonal antibody (M04), clone 2G10

  • Catalog # : H00006895-M04
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant TARBP2.
  • Immunogen:
  • TARBP2 (NP_599150, 141 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • RSPPMELQPPVSPQQSECNPVGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVERFIEIGSGTSKKLAKRNAAAKMLLRVHTVPLDARDGNEVEPDDDHFSIGVG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • TARBP2 monoclonal antibody (M04), clone 2G10. Western Blot analysis of TARBP2 expression in Hela S3 NE.
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of TARBP2 expression in transfected 293T cell line by TARBP2 monoclonal antibody (M04), clone 2G10.

    Lane 1: TARBP2 transfected lysate (Predicted MW: 39 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged TARBP2 is approximately 30ng/ml as a capture antibody.
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Sandwich ELISA (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6895
  • Gene Name:
  • TARBP2
  • Gene Alias:
  • LOQS,TRBP,TRBP1,TRBP2
  • Gene Description:
  • TAR (HIV-1) RNA binding protein 2
  • Gene Summary:
  • HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene binds between the bulge and the loop of the HIV-1 TAR RNA regulatory element and activates HIV-1 gene expression in synergy with the viral Tat protein. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene also has a pseudogene. [provided by RefSeq
  • Other Designations:
  • TAR (HIV) RNA binding protein 2,TAR (HIV) RNA-binding protein 2,TAR (HIV) RNA-binding protein TRBP1,TAR RNA binding protein 2,TAR RNA-binding protein 2,trans-activation responsive RNA-binding protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook