Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

CLEC11A (Human) Recombinant Protein (Q01) 

  • Catalog # : H00006320-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CLEC11A partial ORF ( NP_002966, 214 a.a. - 323 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • PADRQQMEALTRYLRAALAPYNWPVWLGVHDRRAEGLYLFENGQRVSFFAWHRSPRPELGAQPSASPHPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.84
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006320-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Interspecies Antigen Sequence:
  • Mouse (88); Rat (89)
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6320
  • Gene Name:
  • CLEC11A
  • Gene Alias:
  • CLECSF3,LSLCL,P47,SCGF
  • Gene Description:
  • C-type lectin domain family 11, member A
  • Gene Summary:
  • This gene encodes a member of the C-type lectin superfamily. The encoded protein is a secreted sulfated glycoprotein and functions as a growth factor for primitive hematopoietic progenitor cells. An alternative splice variant has been described but its biological nature has not been determined. [provided by RefSeq
  • Other Designations:
  • C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 3,lymphocyte secreted long form of C-type lectin,stem cell growth factor,stem cell growth factor; lymphocyte secreted C-type lectin
  • RSS
  • YouTube
  • Linkedin
  • Facebook