Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CLEC11A monoclonal antibody (M01), clone 3E1 

  • Catalog # : H00006320-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant CLEC11A.
  • Immunogen:
  • CLEC11A (NP_002966, 214 a.a. ~ 323 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • PADRQQMEALTRYLRAALAPYNWPVWLGVHDRRAEGLYLFENGQRVSFFAWHRSPRPELGAQPSASPHPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2b lambda
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Interspecies Antigen Sequence:
  • Mouse (88); Rat (89)
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6320
  • Gene Name:
  • CLEC11A
  • Gene Alias:
  • CLECSF3,LSLCL,P47,SCGF
  • Gene Description:
  • C-type lectin domain family 11, member A
  • Gene Summary:
  • This gene encodes a member of the C-type lectin superfamily. The encoded protein is a secreted sulfated glycoprotein and functions as a growth factor for primitive hematopoietic progenitor cells. An alternative splice variant has been described but its biological nature has not been determined. [provided by RefSeq
  • Other Designations:
  • C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 3,lymphocyte secreted long form of C-type lectin,stem cell growth factor,stem cell growth factor; lymphocyte secreted C-type lectin
  • RSS
  • YouTube
  • Linkedin
  • Facebook