PRPH monoclonal antibody (M02), clone 3B3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PRPH monoclonal antibody (M02), clone 3B3. Western Blot analysis of PRPH expression in IMR-32(Cat # L008V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PRPH on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PRPH is 1 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to PRPH on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.41 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PRPH.
Immunogen
PRPH (NP_006253, 374 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RHLREYQELLNVKMALDIEIATYRKLLEGEESRISVPVHSFASLNIKTTVPEVEPPQDSHSRKTVLIKTIETRNGEVVTESQKEQRSELDKSSAHSY
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.41 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PRPH monoclonal antibody (M02), clone 3B3. Western Blot analysis of PRPH expression in IMR-32(Cat # L008V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PRPH on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PRPH is 1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to PRPH on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — PRPH
Entrez GeneID
5630GeneBank Accession#
NM_006262Protein Accession#
NP_006253Gene Name
PRPH
Gene Alias
NEF4, PRPH1
Gene Description
peripherin
Gene Ontology
HyperlinkGene Summary
This gene encodes a cytoskeletal protein found in neurons of the peripheral nervous system. The encoded protein is a type III intermediate filament protein with homology to other cytoskeletal proteins such as desmin, and is a different protein that the peripherin found in photoreceptors. Mutations in this gene have been associated with susceptibility to amyotrophic lateral sclerosis. [provided by RefSeq
Other Designations
neurofilament 4 (57kD)
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
In vivo survival and differentiation of Friedreich ataxia iPSC-derived sensory neurons transplanted in the adult dorsal root ganglia.
Serena Viventi, Stefano Frausin, Sara E Howden, Shiang Y Lim, Rocio K Finol-Urdaneta, Jeffrey R McArthur, Kwaku Dad Abu-Bonsrah, Wayne Ng, Jason Ivanusic, Lachlan Thompson, Mirella Dottori.
Stem Cells Translational Medicine 2021 Aug; 10(8):1157.
Application：IF, IHC-Fr, Rat, Rat dorsal root ganglia.
-
In vivo survival and differentiation of Friedreich ataxia iPSC-derived sensory neurons transplanted in the adult dorsal root ganglia.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com