PCNA monoclonal antibody (M04), clone S1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant PCNA.
Immunogen
PCNA (AAH00491, 1 a.a. ~ 261 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
Host
Mouse
Reactivity
Human, Mouse, Rat
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (54.45 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PCNA monoclonal antibody (M04), clone S1. Western Blot analysis of PCNA expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
PCNA monoclonal antibody (M04), clone S1. Western Blot analysis of PCNA expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
PCNA monoclonal antibody (M04), clone S1 Western Blot analysis of PCNA expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
PCNA monoclonal antibody (M04), clone S1. Western Blot analysis of PCNA expression in PC-12 ( Cat # L012V1 ).Western Blot (Transfected lysate)
Western Blot analysis of PCNA expression in transfected 293T cell line by PCNA monoclonal antibody (M04), clone S1.
Lane 1: PCNA transfected lysate(28.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PCNA is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — PCNA
Entrez GeneID
5111GeneBank Accession#
BC000491Protein Accession#
AAH00491Gene Name
PCNA
Gene Alias
MGC8367
Gene Description
proliferating cell nuclear antigen
Omim ID
176740Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is found in the nucleus and is a cofactor of DNA polymerase delta. The encoded protein acts as a homotrimer and helps increase the processivity of leading strand synthesis during DNA replication. In response to DNA damage, this protein is ubiquitinated and is involved in the RAD6-dependent DNA repair pathway. Two transcript variants encoding the same protein have been found for this gene. Pseudogenes of this gene have been described on chromosome 4 and on the X chromosome. [provided by RefSeq
Other Designations
DNA polymerase delta auxiliary protein|OTTHUMP00000030189|OTTHUMP00000030190|cyclin
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
DNA Topoisomerase III Alpha Regulates p53-Mediated Tumor Suppression.
Hsieh MY, Fan JR, Chang HW, Chen HC, Shen TL, Teng SC, Yeh YH, Li TK.
Clinical Cancer Research 2014 Mar; 20(6):1489.
Application:IP, Human, HCT116, RHEK-1, H1299 cells and AGS gastric cancer cells.
-
DNA Topoisomerase III Alpha Regulates p53-Mediated Tumor Suppression.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com