Product Browser

Last updated: 2014/4/14
  • Related Product Showcase

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

HLA-DQB1 monoclonal antibody (M02), clone 1G6

  • Catalog # : H00003119-M02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant HLA-DQB1.
  • Immunogen:
  • HLA-DQB1 (AAH12106.1, 129 a.a. ~ 217 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • PTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQNPII
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2b Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003119-M02
    Western Blot detection against Immunogen (35.42 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged HLA-DQB1 is 0.3 ng/ml as a capture antibody.
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3119
  • Gene Name:
  • HLA-DQB1
  • Gene Alias:
  • CELIAC1,HLA-DQB,IDDM1
  • Gene Description:
  • major histocompatibility complex, class II, DQ beta 1
  • Gene Summary:
  • HLA-DQB1 belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and it contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to 4 different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation. [provided by RefSeq
  • Other Designations:
  • MHC DQ beta,MHC class II DQ beta chain,MHC class II HLA-DQ beta glycoprotein,MHC class II antigen DQB1,MHC class II antigen HLA-DQ-beta-1,MHC class2 antigen,OTTHUMP00000178570,lymphocyte antigen,major histocompatibility complex class II beta
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook