HLA-DOB MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
HLA-DOB MaxPab rabbit polyclonal antibody. Western Blot analysis of HLA-DOB expression in human placenta.
Western Blot (Transfected lysate)
Western Blot analysis of HLA-DOB expression in transfected 293T cell line (H00003112-T01) by HLA-DOB MaxPab polyclonal antibody.
Lane 1: HLA-DOB transfected lysate(30.80 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of HLA-DOB transfected lysate using anti-HLA-DOB MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with HLA-DOB purified MaxPab mouse polyclonal antibody (B01P) (H00003112-B01P).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human HLA-DOB protein.
Immunogen
HLA-DOB (NP_002111.1, 1 a.a. ~ 273 a.a) full-length human protein.
Sequence
MGSGWVPWVVALLVNLTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNLEEYVRFDSDVGMFVALTKLGQPDAEQWNSRLDLLERSRQAVDGVCRHNYRLGAPFTVGRKVQPEVTVYPERTPLLHQHNLLHCSVTGFYPGDIKIKWFLNGQEERAGVMSTGPIRNGDWTFQTVVMLEMTPELGHVYTCLVDHSSLLSPVSVEWRAQSEYSWRKMLSGIAAFLLGLIFLLVGIVIQLRAQKGYVRTQMSGNEVSRAVLLPQSC
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
HLA-DOB MaxPab rabbit polyclonal antibody. Western Blot analysis of HLA-DOB expression in human placenta.Western Blot (Transfected lysate)
Western Blot analysis of HLA-DOB expression in transfected 293T cell line (H00003112-T01) by HLA-DOB MaxPab polyclonal antibody.
Lane 1: HLA-DOB transfected lysate(30.80 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of HLA-DOB transfected lysate using anti-HLA-DOB MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with HLA-DOB purified MaxPab mouse polyclonal antibody (B01P) (H00003112-B01P). -
Gene Info — HLA-DOB
Entrez GeneID
3112GeneBank Accession#
NM_002120Protein Accession#
NP_002111.1Gene Name
HLA-DOB
Gene Alias
DOB
Gene Description
major histocompatibility complex, class II, DO beta
Omim ID
600629Gene Ontology
HyperlinkGene Summary
HLA-DOB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DOA) and a beta chain (DOB), both anchored in the membrane. It is located in intracellular vesicles. DO suppresses peptide loading of MHC class II molecules by inhibiting HLA-DM. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. [provided by RefSeq
Other Designations
HLA class II histocompatibility antigen, DO beta chain|OTTHUMP00000029312|class II beta chain
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com