Product Browser

Last updated: 2014/4/14
  • Related Product Showcase

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

HLA-DOB MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00003112-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human HLA-DOB protein.
  • Immunogen:
  • HLA-DOB (NP_002111.1, 1 a.a. ~ 273 a.a) full-length human protein.
  • Sequence:
  • MGSGWVPWVVALLVNLTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNLEEYVRFDSDVGMFVALTKLGQPDAEQWNSRLDLLERSRQAVDGVCRHNYRLGAPFTVGRKVQPEVTVYPERTPLLHQHNLLHCSVTGFYPGDIKIKWFLNGQEERAGVMSTGPIRNGDWTFQTVVMLEMTPELGHVYTCLVDHSSLLSPVSVEWRAQSEYSWRKMLSGIAAFLLGLIFLLVGIVIQLRAQKGYVRTQMSGNEVSRAVLLPQSC
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • HLA-DOB MaxPab rabbit polyclonal antibody. Western Blot analysis of HLA-DOB expression in human placenta.
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of HLA-DOB expression in transfected 293T cell line (H00003112-T01) by HLA-DOB MaxPab polyclonal antibody.

    Lane 1: HLA-DOB transfected lysate(30.80 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of HLA-DOB transfected lysate using anti-HLA-DOB MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with HLA-DOB purified MaxPab mouse polyclonal antibody (B01P) (H00003112-B01P).
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 3112
  • Gene Name:
  • HLA-DOB
  • Gene Alias:
  • DOB
  • Gene Description:
  • major histocompatibility complex, class II, DO beta
  • Gene Summary:
  • HLA-DOB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DOA) and a beta chain (DOB), both anchored in the membrane. It is located in intracellular vesicles. DO suppresses peptide loading of MHC class II molecules by inhibiting HLA-DM. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. [provided by RefSeq
  • Other Designations:
  • HLA class II histocompatibility antigen, DO beta chain,OTTHUMP00000029312,class II beta chain
  • RSS
  • YouTube
  • Linkedin
  • Facebook