Product Browser

Last updated: 2014/4/21
  • Related Product Showcase

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

FCGR2B monoclonal antibody (M01A), clone 2E10

  • Catalog # : H00002213-M01A
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant FCGR2B.
  • Immunogen:
  • FCGR2B (AAH31992, 45 a.a. ~ 154 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • AAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVVRCHS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00002213-M01A
    Western Blot detection against Immunogen (37.84 KDa) .
  • Storage Buffer:
  • In ascites fluid
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • FCGR2B monoclonal antibody (M01A), clone 2E10 Western Blot analysis of FCGR2B expression in K-562 ( Cat # L009V1 ).
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of FCGR2B expression in transfected 293T cell line by FCGR2B monoclonal antibody (M01A), clone 2E10.

    Lane 1: FCGR2B transfected lysate(34 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 2213
  • Gene Name:
  • FCGR2B
  • Gene Alias:
  • CD32,CD32B,FCG2,FCGR2,IGFR2
  • Gene Description:
  • Fc fragment of IgG, low affinity IIb, receptor (CD32)
  • Other Designations:
  • Fc fragment of IgG, low affinity II, receptor for (CD32),Fc fragment of IgG, low affinity IIb, receptor for (CD32),Fc gamma RIIb,OTTHUMP00000032379
  • RSS
  • YouTube
  • Linkedin
  • Facebook