CSF1R monoclonal antibody (M02), clone 3G12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CSF1R monoclonal antibody (M02), clone 3G12 Western Blot analysis of CSF1R expression in Hela S3 NE ( Cat # L013V3 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CSF1R is approximately 0.3ng/ml as a capture antibody.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between PIK3R1 and CSF1R. HeLa cells were stained with anti-PIK3R1 rabbit purified polyclonal 1:1200 and anti-CSF1R mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CSF1R.
Immunogen
CSF1R (AAH47521, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTLYSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFED
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (73); Rat (79)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CSF1R monoclonal antibody (M02), clone 3G12 Western Blot analysis of CSF1R expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CSF1R is approximately 0.3ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between PIK3R1 and CSF1R. HeLa cells were stained with anti-PIK3R1 rabbit purified polyclonal 1:1200 and anti-CSF1R mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — CSF1R
Entrez GeneID
1436GeneBank Accession#
BC047521Protein Accession#
AAH47521Gene Name
CSF1R
Gene Alias
C-FMS, CD115, CSFR, FIM2, FMS
Gene Description
colony stimulating factor 1 receptor
Omim ID
164770Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is the receptor for colony stimulating factor 1, a cytokine which controls the production, differentiation, and function of macrophages. This receptor mediates most if not all of the biological effects of this cytokine. Ligand binding activates the receptor kinase through a process of oligomerization and transphosphorylation. The encoded protein is a tyrosine kinase transmembrane receptor and member of the CSF1/PDGF receptor family of tyrosine-protein kinases. Mutations in this gene have been associated with a predisposition to myeloid malignancy. The first intron of this gene contains a transcriptionally inactive ribosomal protein L7 processed pseudogene oriented in the opposite direction. [provided by RefSeq
Other Designations
CD115 antigen|FMS proto-oncogene|McDonough feline sarcoma viral (v-fms) oncogene homolog|macrophage colony stimulating factor I receptor|soluble CSF1R variant 1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com