MAPK14 monoclonal antibody (M01), clone 3D5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MAPK14.
Immunogen
MAPK14 (AAH31574, 260 a.a. ~ 360 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
MAPK14 monoclonal antibody (M01), clone 3D5 Western Blot analysis of MAPK14 expression in C32 ( Cat # L002V1 ).Western Blot (Transfected lysate)
Western Blot analysis of MAPK14 expression in transfected 293T cell line by MAPK14 monoclonal antibody (M01), clone 3D5.
Lane 1: MAPK14 transfected lysate(41.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MAPK14 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of MAPK14 transfected lysate using anti-MAPK14 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with MAPK14 monoclonal antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between AKT1 and MAPK14. HeLa cells were stained with anti-AKT1 rabbit purified polyclonal 1:1200 and anti-MAPK14 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between AKT1 and MAPK14. Huh7 cells were stained with anti-AKT1 rabbit purified polyclonal 1:1200 and anti-MAPK14 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — MAPK14
Entrez GeneID
1432GeneBank Accession#
BC031574Protein Accession#
AAH31574Gene Name
MAPK14
Gene Alias
CSBP1, CSBP2, CSPB1, EXIP, Mxi2, PRKM14, PRKM15, RK, SAPK2A, p38, p38ALPHA
Gene Description
mitogen-activated protein kinase 14
Omim ID
600289Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various environmental stresses and proinflammatory cytokines. The activation requires its phosphorylation by MAP kinase kinases (MKKs), or its autophosphorylation triggered by the interaction of MAP3K7IP1/TAB1 protein with this kinase. The substrates of this kinase include transcription regulator ATF2, MEF2C, and MAX, cell cycle regulator CDC25B, and tumor suppressor p53, which suggest the roles of this kinase in stress related transcription and cell cycle regulation, as well as in genotoxic stress response. Four alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq
Other Designations
Csaids binding protein|MAP kinase Mxi2|MAX-interacting protein 2|cytokine suppressive anti-inflammatory drug binding protein|p38 MAP kinase|p38 mitogen activated protein kinase|p38alpha Exip|stress-activated protein kinase 2A
-
Interactome
-
Pathway
- Amyotrophic lateral sclerosis (ALS)
- Epithelial cell signaling in Helicobacter pylori infection
- Fc epsilon RI signaling pathway
- GnRH signaling pathway
- Leukocyte transendothelial migration
- MAPK signaling pathway
- Neurotrophin signaling pathway
- T cell receptor signaling pathway
- Toll-like receptor signaling pathway
+ View More Disease
-
Disease
-
Publication Reference
-
p38 predicts depression and poor outcome in esophageal cancer.
Cheng Y, Qiao Z, Dang C, Zhou B, Li S, Zhang W, Jiang J, Song Y, Zhang J, Diao D.
Oncology Letters 2017 Dec; 4(6):7241.
Application:IHC-P, Human, Human esophageal cancer.
-
p38 predicts depression and poor outcome in esophageal cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com