CCND3 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CCND3 MaxPab rabbit polyclonal antibody. Western Blot analysis of CCND3 expression in Jurkat.
Western Blot (Transfected lysate)
Western Blot analysis of CCND3 expression in transfected 293T cell line (H00000896-T01) by CCND3 MaxPab polyclonal antibody.
Lane 1: CCND3 transfected lysate(32.50 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between CCND3 and AREG. HeLa cells were stained with anti-CCND3 rabbit purified polyclonal 1:1200 and anti-AREG mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human CCND3 protein.
Immunogen
CCND3 (NP_001751.1, 1 a.a. ~ 292 a.a) full-length human protein.
Sequence
MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CCND3 MaxPab rabbit polyclonal antibody. Western Blot analysis of CCND3 expression in Jurkat.Western Blot (Transfected lysate)
Western Blot analysis of CCND3 expression in transfected 293T cell line (H00000896-T01) by CCND3 MaxPab polyclonal antibody.
Lane 1: CCND3 transfected lysate(32.50 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between CCND3 and AREG. HeLa cells were stained with anti-CCND3 rabbit purified polyclonal 1:1200 and anti-AREG mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — CCND3
Entrez GeneID
896GeneBank Accession#
NM_001760Protein Accession#
NP_001751.1Gene Name
CCND3
Gene Alias
-
Gene Description
cyclin D3
Omim ID
123834Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activtiy is required for cell cycle G1/S transition. This protein has been shown to interact with and be involved in the phosphorylation of tumor suppressor protein Rb. The CDK4 activity associated with this cyclin was reported to be necessary for cell cycle progression through G2 phase into mitosis after UV radiation. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
D3-type cyclin|G1/S-specific cyclin D3|OTTHUMP00000016390
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Myeloid leukemia factor-1 is a novel modulator of neonatal rat cardiomyocyte proliferation.
Rangrez AY, Pott J, Kluge A, Frauen R, Stiebeling K, Hoppe P, Sossalla S, Frey N, Frank D.
Biochimica et Biophysica Acta 2017 Jan; 1864(4):634.
Application：WB, Rat, Neonatal rat cardiomyocytes (NRVCMs).
-
Myeloid leukemia factor-1 is a novel modulator of neonatal rat cardiomyocyte proliferation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com