APOA1 monoclonal antibody (M01), clone S1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant APOA1.
Immunogen
APOA1 (AAH05380, 1 a.a. ~ 267 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (55.11 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
APOA1 monoclonal antibody (M01), clone 3A11-1A9. Western Blot analysis of APOA1 expression in human kidney.Western Blot (Transfected lysate)
Western Blot analysis of APOA1 expression in transfected 293T cell line by APOA1 monoclonal antibody (M01), clone 3A11-1A9.
Lane 1: APOA1 transfected lysate (Predicted MW: 30.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of APOA1 transfected lysate using anti-APOA1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with APOA1 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged APOA1 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — APOA1
Entrez GeneID
335GeneBank Accession#
BC005380Protein Accession#
AAH05380Gene Name
APOA1
Gene Alias
MGC117399
Gene Description
apolipoprotein A-I
Gene Ontology
HyperlinkGene Summary
This gene encodes apolipoprotein A-I, which is the major protein component of high density lipoprotein (HDL) in plasma. The protein promotes cholesterol efflux from tissues to the liver for excretion, and it is a cofactor for lecithin cholesterolacyltransferase (LCAT) which is responsible for the formation of most plasma cholesteryl esters. This gene is closely linked with two other apolipoprotein genes on chromosome 11. Defects in this gene are associated with HDL deficiencies, including Tangier disease, and with systemic non-neuropathic amyloidosis. [provided by RefSeq
Other Designations
OTTHUMP00000069346|OTTHUMP00000069347|OTTHUMP00000069348|apolipoprotein A1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Elevated IgM against Nε-(Carboxyethyl)lysine-modified Apolipoprotein A1 peptide 141-147 in Taiwanese with Alzheimer's disease.
Lin CY, Sheu JJ, Tsai IS, Wang ST, Yang LY, Hsu IU, Chang HW, Lee HM, Kao SH, Lee CK, Chen CH, Lin YF.
Clinical Biochemistry 2018 Jun; 56:75.
Application:IP, WB, Human, Human serum.
-
Elevated IgM against Nε-(Carboxyethyl)lysine-modified Apolipoprotein A1 peptide 141-147 in Taiwanese with Alzheimer's disease.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com