Product Browser

Last updated: 2015/8/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

APEX1 (Human) Recombinant Protein (P01)

  • Catalog # : H00000328-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human APEX1 full-length ORF ( AAH02338, 1 a.a. - 318 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 60.72
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000328-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 328
  • Gene Name:
  • APEX1
  • Gene Alias:
  • APE,APE-1,APE1,APEN,APEX,APX,HAP1,REF-1,REF1
  • Gene Description:
  • APEX nuclease (multifunctional DNA repair enzyme) 1
  • Gene Summary:
  • Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone 5' to the AP site. This gene encodes the major AP endonuclease in human cells. Splice variants have been found for this gene; all encode the same protein. [provided by RefSeq
  • Other Designations:
  • AP endonuclease class I,AP lyase,APEX nuclease,DNA-(apurinic or apyrimidinic site) lyase,OTTHUMP00000163988,apurinic/apyrimidinic (abasic) endonuclease,apurinic/apyrimidinic exonuclease,deoxyribonuclease (apurinic or apyrimidinic),multifunctional DNA repa
  • Gene Pathway
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook