Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FSHB polyclonal antibody

  • Catalog # : PAB8953
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against synthetic peptide of FSHB.
  • Immunogen:
  • A synthetic peptide corresponding to amino acids 47-84 of human FSHB.
  • Sequence:
  • IQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCH
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse, Rat
  • Form:
  • Liquid
  • Quality Control Testing:
  • Antibody Reactive Against Synthetic Peptide.
  • Recommend Usage:
  • Immunohistochemistry (1:250)
    ELISA (1:50000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In buffer containing 0.02% sodium azide
  • Storage Instruction:
  • Store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Publication Reference
  • Applications
  • Immunohistochemistry
  • ELISA
  • Dot Blot
  • Application Image
  • Immunohistochemistry
  • ELISA
  • Dot Blot
  • Gene Information
  • Entrez GeneID:
  • 2488
  • Gene Name:
  • FSHB
  • Gene Alias:
  • -
  • Gene Description:
  • follicle stimulating hormone, beta polypeptide
  • Gene Summary:
  • The pituitary glycoprotein hormone family includes follicle-stimulating hormone, luteinizing hormone, chorionic gonadotropin, and thyroid-stimulating hormone. All of these glycoproteins consist of an identical alpha subunit and a hormone-specific beta subunit. This gene encodes the beta subunit of follicle-stimulating hormone. In conjunction with luteinizing hormone, follicle-stimulating hormone induces egg and sperm production. Alternative splicing results in two transcript variants encoding the same protein. [provided by RefSeq
  • Other Designations:
  • follicle-stimulating hormone beta subunit,follitropin, beta chain
  • RSS
  • YouTube
  • Linkedin
  • Facebook