Product Browser

Last updated: 2022/8/14

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

POU2F3 polyclonal antibody 

  • Catalog # : PAB31835
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant human POU2F3.
  • Sequence:
  • LESMHTDIKMSGDVADSTDARSTLSQVEPGNDRNGLDFNRQIKTEDLSDSLQQTLSHRPCHLSQGPAMMSGNQMSGLNASPCQDMASLHPLQQLVLVPGHLQSVSQFLLSQTQP
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Specificity:
  • This antibody reacts to POU2F3.
  • Form:
  • Liquid
  • Purification:
  • Affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:200 - 1:500)
    Western Blot (0.04-0.4 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of control (vector only transfected HEK293T lysate) and POU2F3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human kidney shows no positivity in tubules.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human skin shows strong nuclear positivity in keratinocytes.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • POU2F3
  • Gene Alias:
  • Epoc-1,FLJ40063,MGC126698,OCT11,PLA-1,Skn-1a
  • Gene Description:
  • POU class 2 homeobox 3
  • Other Designations:
  • POU domain, class 2, transcription factor 3,POU transcription factor
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook