Product Browser

Last updated: 2022/5/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MUC5B polyclonal antibody 

  • Catalog # : PAB31834
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit monoclonal antibody raised against recombinant human MUC5B.
  • Sequence:
  • CTCTYEDRTYSYQDVIYNTTDGLGACLIAICGSNGTIIRKAVACPGTPATTPFTFTTAWVPHSTTSPALPVSTVCVREVCRWSSWYNGHRPEPGLGGGDFETFENLRQRGYQVCPVLA
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Specificity:
  • This antibody reacts to MUC5B.
  • Form:
  • Liquid
  • Purification:
  • Affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (0.25-2 ug/mL)
    Immunohistochemistry (1:500 - 1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human lower gastrointestinal shows strong extracellular space positivity in glandular cells.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human cervix shows very strong extracellular space positivity in glandular cells.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line A549 shows localization to vesicles.
  • Application Image
  • Gene Information
  • Gene Name:
  • MUC5B
  • Gene Alias:
  • MG1,MUC5,MUC9
  • Gene Description:
  • mucin 5B, oligomeric mucus/gel-forming
  • Gene Summary:
  • Mucins are high molecular mass, highly glycosylated macromolecules that are the major components of mucus secretions. MUC5B is a salivary mucin that is thought to contribute to the lubricating and viscoelastic properties of whole saliva. It is composed of 14.9% protein, 78.1% carbohydrate, and 7% sulfate (Troxler et al., 1995 [PubMed 8554565]).[supplied by OMIM
  • Other Designations:
  • cervical mucin MUC5B,high molecular weight mucin,mucin 5, subtype B, tracheobronchial,mucin, salivary (high molecular weight)
  • RSS
  • YouTube
  • Linkedin
  • Facebook