Product Browser

Last updated: 2022/5/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PCM1 polyclonal antibody 

  • Catalog # : PAB31833
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit monoclonal antibody raised against recombinant human PCM1.
  • Sequence:
  • EEEGVSGASLSSHRSSLVDEHPEDAEFEQKINRLMAAKQKLRQLQDLVAMVQDDDAAQGVISASASNLDDFYPAEEDTKQNSNNTRGNANKTQKDT
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Specificity:
  • This antibody reacts to PCM1.
  • Form:
  • Liquid
  • Purification:
  • Affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (0.25-2 ug/mL)
    Immunohistochemistry (1:1000 - 1:2500)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in seminiferous ducts.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human ovary using PCM1 polyclonal antibody (Cat # PAB31833).
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human cerebral cortex shows weak cytoplasmic positivity in neuronal cells.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human liver using PCM1 polyclonal antibody (Cat # PAB31833).
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line A-431 shows localization to centrosome.
  • Application Image
  • Gene Information
  • Entrez GeneID:
  • 5108
  • Gene Name:
  • PCM1
  • Gene Alias:
  • PTC4
  • Gene Description:
  • pericentriolar material 1
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook