Product Browser

Last updated: 2022/5/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RHOT1 polyclonal antibody 

  • Catalog # : PAB31832
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit monoclonal antibody raised against recombinant human RHOT1.
  • Sequence:
  • THIVDYSEAEQSDEQLHQEISQANVICIVYAVNNKHSIDKVTSRWIPLIN ERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIE
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Specificity:
  • This antibody reacts to RHOT1.
  • Form:
  • Liquid
  • Purification:
  • Affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:200 - 1:500)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human small intestine shows positivity in glandular cells.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human pancreas shows positivity in exocrine glandular cells.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human cerebral cortex shows positivity in neuronal cells.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human cerebellum shows positivity in neuronal cells.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human liver shows positivity in hepatocytes.
  • Application Image
  • Gene Information
  • Gene Name:
  • RHOT1
  • Gene Alias:
  • ARHT1,FLJ11040,FLJ12633,MIRO-1
  • Gene Description:
  • ras homolog gene family, member T1
  • Other Designations:
  • mitochondrial Rho 1,rac-GTP binding protein-like protein
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook