Product Browser

Last updated: 2022/5/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

WWTR1 polyclonal antibody 

  • Catalog # : PAB31829
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit monoclonal antibody raised against recombinant human WWTR1.
  • Sequence:
  • MNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSST
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse, Rat
  • Specificity:
  • This antibody reacts to WWTR1.
  • Form:
  • Liquid
  • Purification:
  • Affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (0.25-2 ug/mL)
    Immunohistochemistry (1:200 - 1:500)
    Western Blot (0.04-0.4 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of mouse cell line NIH-3T3 and rat cell line NBT-II.
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western blot analysis of EFO-21 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using WWTR1 polyclonal antibody (Cat # PAB31829). Loading control: Anti-PPIB
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human kidney shows moderate nuclear positivity in glomerular cells and a subset of cells in distal tubules.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human renal cancer shows strong nuclear positivity in tumor cells.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human placenta shows strong nuclear positivity in endothelial cells.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human skeletal muscle shows weak positivity in myocytes.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human colon shows strong nuclear positivity in a subset of lymphoid cells.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, nuclear bodies and cytosol.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • WWTR1
  • Gene Alias:
  • DKFZp586I1419,TAZ
  • Gene Description:
  • WW domain containing transcription regulator 1
  • Other Designations:
  • transcriptional co-activator with PDZ-binding motif (TAZ)
  • RSS
  • YouTube
  • Linkedin
  • Facebook