Product Browser

Last updated: 2022/7/3

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

AQP4 polyclonal antibody 

  • Catalog # : PAB31827
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant human AQP4.
  • Sequence:
  • CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse
  • Specificity:
  • This antibody reacts to AQP4.
  • Form:
  • Liquid
  • Purification:
  • Affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (0.25-2 ug/mL)
    Immunohistochemistry (1:2500 - 1:5000)
    Western Blot (0.04-0.4 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • Western blot analysis of human brain tissue.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human stomach shows strong membranous positivity in glandular cells.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human cerebral cortex shows strong membranous positivity in astrocytes.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human cerebellum shows strong membranous positivity in astrocytes, mainly in the molecular layer.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human liver shows no positivity in hepatocytes, as expected.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of mouse cerebellum shows positivity in astrocytes, mainly in the molecular layer.
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 361
  • Gene Name:
  • AQP4
  • Gene Alias:
  • HMIWC2,MGC22454,MIWC
  • Gene Description:
  • aquaporin 4
  • Gene Summary:
  • This gene encodes a member of the aquaporin family of intrinsic membrane proteins that function as water-selective channels in the plasma membranes of many cells. The encoded protein is the predominant aquaporin found in brain. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • aquaporin type4,aquaporin-4,mercurial-insensitive water channel
  • RSS
  • YouTube
  • Linkedin
  • Facebook