Product Browser

Last updated: 2022/5/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TFE3 polyclonal antibody 

  • Catalog # : PAB31826
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit monoclonal antibody raised against recombinant human TFE3.
  • Sequence:
  • SKDLESRQRSLEQANRSLQLRIQELELQAQIHGLPVPPTPGLLSLATTSASDSLKPEQLDIEEEGRPGAATFHVGGGPAQNAPHQQPPAPPSDALLDLHFPSDHLGDLGDPFHLGLEDILMEEEEGVVGGLSGGALSPLRAAS
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse, Rat
  • Specificity:
  • This antibody reacts to TFE3.
  • Form:
  • Liquid
  • Purification:
  • Affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (0.25-2 ug/mL)
    Immunohistochemistry (1:500 - 1:1000)
    Western Blot (0.04-0.4 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of mouse cell line NIH-3T3 and rat cell line NBT-II.
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western blot analysis of U-87MG cells transfected with control siRNA, target specific siRNA probe # 1 and probe # 2, using TFE3 polyclonal antibody (Cat # PAB31826). Loading control: Anti-GAPDH.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human kidney shows moderate nuclear positivity in renal glomeruli and tubuli cells.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human prostate shows strong nuclear positivity in glandular cells.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm and cytosol.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 7030
  • Gene Name:
  • TFE3
  • Gene Alias:
  • RCCP2,TFEA,bHLHe33
  • Gene Description:
  • transcription factor binding to IGHM enhancer 3
  • Gene Summary:
  • TFE3, a member of the helix-loop-helix family of transcription factors, binds to the mu-E3 motif of the immunoglobulin heavy-chain enhancer and is expressed in many cell types (Henthorn et al., 1991 [PubMed 1685140]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000024272,Renal cell carcinoma, papillary,Transcription factor for IgH enhancer,transcription factor E family, member A,transcription factor E3
  • RSS
  • YouTube
  • Linkedin
  • Facebook