LCP1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human LCP1.
Immunogen
Recombinant protein corresponding to amino acids 18-77 of human LCP1.
Sequence
FAKVDTDGNGYISFNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGRISFDEFIKI
Host
Rabbit
Reactivity
Human, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (0.4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of human cell line RT-4.Western Blot
Western Blot analysis of (1) NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), and (2) NBT-II cell lysate (Rat Wistar bladder tumour cells).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human spleen and skeletal muscle tissues. Corresponding LCP1 RNA-seq data are presented for the same tissues.Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane, cytosol & actin filaments. Antibody staining is shown in green. -
Gene Info — LCP1
Entrez GeneID
3936Protein Accession#
P13796Gene Name
LCP1
Gene Alias
CP64, DKFZp781A23186, FLJ25423, FLJ26114, FLJ39956, L-PLASTIN, LC64P, LPL, PLS2
Gene Description
lymphocyte cytosolic protein 1 (L-plastin)
Omim ID
153430Gene Ontology
HyperlinkGene Summary
Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. Plastin 1 (otherwise known as Fimbrin) is a third distinct plastin isoform which is specifically expressed at high levels in the small intestine. The L isoform is expressed only in hemopoietic cell lineages, while the T isoform has been found in all other normal cells of solid tissues that have replicative potential (fibroblasts, endothelial cells, epithelial cells, melanocytes, etc.). However, L-plastin has been found in many types of malignant human cells of non-hemopoietic origin suggesting that its expression is induced accompanying tumorigenesis in solid tissues. [provided by RefSeq
Other Designations
L-plastin|L-plastin (Lymphocyte cytosolic protein 1) (LCP-1) (LC64P)|Lymphocyte cytosolic protein-1 (plasmin)|OTTHUMP00000018362|bA139H14.1 (lymphocyte cytosolic protein 1 (L-plastin))|plastin 2
-
Interactome
-
Disease
-
Publication Reference
-
Affinity proteomics reveals elevated muscle proteins in plasma of children with cerebral malaria.
Bachmann J, Burte F, Pramana S, Conte I, Brown BJ, Orimadegun AE, Ajetunmobi WA, Afolabi NK, Akinkunmi F, Omokhodion S, Akinbami FO, Shokunbi WA, Kampf C, Pawitan Y, Uhlen M, Sodeinde O, Schwenk JM, Wahlgren M, Fernandez-Reyes D, Nilsson P.
PLoS Pathogens 2014 Apr; 10(4):e1004038.
Application:Array, Human, Human plasma.
-
Affinity proteomics reveals elevated muscle proteins in plasma of children with cerebral malaria.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com