ACO1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of human cell line U-87 MG.
Western Blot
Western Blot analysis of (1) NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), and (2) NBT-II cell lysate (Rat Wistar bladder tumour cells).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney shows strong positivity in renal tubuli.
Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & mitochondria. Antibody staining is shown in green.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human ACO1.
Immunogen
Recombinant protein corresponding to amino acids 800-889 of human ACO1.
Sequence
YERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (0.4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of human cell line U-87 MG.Western Blot
Western Blot analysis of (1) NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), and (2) NBT-II cell lysate (Rat Wistar bladder tumour cells).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney shows strong positivity in renal tubuli.Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & mitochondria. Antibody staining is shown in green. -
Gene Info — ACO1
Entrez GeneID
48Protein Accession#
P21399Gene Name
ACO1
Gene Alias
ACONS, IREB1, IREBP, IREBP1, IRP1
Gene Description
aconitase 1, soluble
Omim ID
100880Gene Ontology
HyperlinkGene Summary
Aconitase 1, also known as iron regulatory element binding protein 1 (IREB1), is a cytosolic protein which binds to iron-responsive elements (IREs). IREs are stem-loop structures found in the 5' UTR of ferritin mRNA, and in the 3' UTR of transferrin receptor mRNA. The iron-induced binding to the IRE results in repression of translation of ferritin mRNA, and inhibition of degradation of the otherwise rapidly degrading transferrin receptor mRNA. Thus, IREB1 plays a central role in cellular iron homeostasis. It was also shown to have aconitase activity, and hence grouped with the aconitase family of enzymes. [provided by RefSeq
Other Designations
OTTHUMP00000021176|OTTHUMP00000021177|OTTHUMP00000045233|aconitase 1|aconitate hydratase|citrate hydro-lyase|ferritin repressor protein|iron regulatory protein 1|iron-responsive element binding protein 1
-
Interactome
-
Pathway
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Citrate cycle (TCA cycle)
- Glyoxylate and dicarboxylate metabolism
+ View More Disease
-
Publication Reference
-
Dysregulation of IRP1-mediated iron metabolism causes gamma ray-specific radioresistance in leukemia cells.
Haro KJ, Sheth A, Scheinberg DA.
PLoS One 2012 Nov; 7(11):e48841.
Application：WB-Ce, Human, HL-60 cells.
-
Dysregulation of IRP1-mediated iron metabolism causes gamma ray-specific radioresistance in leukemia cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com