QKI polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
Western Blot analysis of human cerebral cortex tissue.
Western Blot (Cell lysate)
Western Blot analysis of (1) NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), and (2) NBT-II cell lysate (Rat Wistar bladder tumour cells).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex shows strong nuclear positivity in glial cells.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebellum shows strong positivity in subsets of cells.
Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunofluorescence
Immunofluorescent staining of mouse cerebellum shows strong immunoreactivity in Purkinje cells.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human QKI.
Immunogen
Recombinant protein corresponding to amino acids 163-311 of human QKI.
Sequence
RAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVL
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Tissue lysate)
Western Blot analysis of human cerebral cortex tissue.Western Blot (Cell lysate)
Western Blot analysis of (1) NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), and (2) NBT-II cell lysate (Rat Wistar bladder tumour cells).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex shows strong nuclear positivity in glial cells.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebellum shows strong positivity in subsets of cells.Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.Immunofluorescence
Immunofluorescent staining of mouse cerebellum shows strong immunoreactivity in Purkinje cells. -
Gene Info — QKI
Entrez GeneID
9444Protein Accession#
Q96PU8Gene Name
QKI
Gene Alias
DKFZp586I0923, Hqk, QK, QK1, QK3
Gene Description
quaking homolog, KH domain RNA binding (mouse)
Omim ID
609590Gene Ontology
HyperlinkGene Summary
QKI belongs to a family of RNA-binding proteins that have an HNRNPK (MIM 600712) homology (KH) domain embedded in a 200-amino acid region called the GSG domain. Other members of this family include SAM68 (KHDRBS1; MIM 602489) and SF1 (MIM 601516) (Chen and Richard, 1998 [PubMed 9671495]). QKI proteins regulate RNA splicing, export of target RNAs from the nucleus, translation of proteins, and RNA stability (Lauriat et al., 2008 [PubMed 17918747]).[supplied by OMIM
Other Designations
OTTHUMP00000017581|OTTHUMP00000017582|OTTHUMP00000017583|RNA binding protein HQK|homolog of mouse quaking QKI (KH domain RNA binding protein)|quaking homolog, KH domain RNA binding
-
Interactome
-
Disease
-
Publication Reference
-
Expression of Quaking RNA-Binding Protein in the Adult and Developing Mouse Retina.
Suiko T, Kobayashi K, Aono K, Kawashima T, Inoue K, Ku L, Feng Y, Koike C.
PLoS One 2016 May; 11(5):e0156033.
Application：IF, IHC-Fr, Mouse, Mouse retinas.
-
Expression of Quaking RNA-Binding Protein in the Adult and Developing Mouse Retina.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com