Product Browser

Last updated: 2018/1/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

S100A8 polyclonal antibody

  • Catalog # : PAB31581
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant human S100A8
  • Immunogen:
  • Recombinant protein corresponding to human S100A8.
  • Sequence:
  • LTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKM
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/mL)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:2500-1:5000)
    Western Blot (1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot analysis of SK-BR-3 cell lysate with S100A8 polyclonal antibody (Cat # PAB31581).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lymph node with S100A8 polyclonal antibody (Cat # PAB31581) shows strong cytoplasmic and nuclear positivity in a subset of cells outside reaction centra.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of HaCaT cells with S100A8 polyclonal antibody (Cat # PAB31581) (Green) shows localization to intermediate filaments.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 6279
  • Gene Name:
  • S100A8
  • Gene Alias:
  • 60B8AG,CAGA,CFAG,CGLA,CP-10,L1Ag,MA387,MIF,MRP8,NIF,P8
  • Gene Description:
  • S100 calcium binding protein A8
  • Gene Summary:
  • The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000015329,OTTHUMP00000015330,S100 calcium-binding protein A8,S100 calcium-binding protein A8 (calgranulin A),calgranulin A,cystic fibrosis antigen
  • RSS
  • YouTube
  • Linkedin
  • Facebook