S100A8 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of SK-BR-3 cell lysate with S100A8 polyclonal antibody (Cat # PAB31581).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lymph node with S100A8 polyclonal antibody (Cat # PAB31581) shows strong cytoplasmic and nuclear positivity in a subset of cells outside reaction centra.
Immunofluorescence
Immunofluorescent staining of HaCaT cells with S100A8 polyclonal antibody (Cat # PAB31581) (Green) shows localization to intermediate filaments.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human S100A8.
Immunogen
Recombinant protein corresponding to human S100A8.
Sequence
LTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKM
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:2500-1:5000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of SK-BR-3 cell lysate with S100A8 polyclonal antibody (Cat # PAB31581).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lymph node with S100A8 polyclonal antibody (Cat # PAB31581) shows strong cytoplasmic and nuclear positivity in a subset of cells outside reaction centra.Immunofluorescence
Immunofluorescent staining of HaCaT cells with S100A8 polyclonal antibody (Cat # PAB31581) (Green) shows localization to intermediate filaments. -
Gene Info — S100A8
Entrez GeneID
6279Protein Accession#
P05109Gene Name
S100A8
Gene Alias
60B8AG, CAGA, CFAG, CGLA, CP-10, L1Ag, MA387, MIF, MRP8, NIF, P8
Gene Description
S100 calcium binding protein A8
Omim ID
123885Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis. [provided by RefSeq
Other Designations
OTTHUMP00000015329|OTTHUMP00000015330|S100 calcium-binding protein A8|S100 calcium-binding protein A8 (calgranulin A)|calgranulin A|cystic fibrosis antigen
-
Interactome
-
Disease
-
Publication Reference
-
Comparative proteomic analysis reveals activation of mucosal innate immune signaling pathways during cholera.
Ellis CN, LaRocque RC, Uddin T, Krastins B, Mayo-Smith LM, Sarracino D, Karlsson EK, Rahman A, Shirin T, Bhuiyan TR, Chowdhury F, Khan AI, Ryan ET, Calderwood SB, Qadri F, Harris JB.
Infection and Immunity 2015 Mar; 83(3):1089.
Application：IF, IHC-P, Human, Human duodenal biopsy specimens.
-
Comparative proteomic analysis reveals activation of mucosal innate immune signaling pathways during cholera.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com