DMRT1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with DMRT1 polyclonal antibody (Cat # PAB31552).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with DMRT1 polyclonal antibody (Cat # PAB31552) shows strong nuclear positivity in fraction of cells in seminiferous ducts.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human DMRT1.
Immunogen
Recombinant protein corresponding to human DMRT1.
Sequence
LAADSASGEVGNPLGGSPVKNSLRGLPGPYVPGQTGNQWQMKNMENRHAMSSQYRMHSYYPPPSYLGQSVPQFFTFEDAPSYPEARASVFSPPSSQDSGLVSLSSSSPISNKSTKAVLECEPASEPSSFTVTPVI
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with DMRT1 polyclonal antibody (Cat # PAB31552).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with DMRT1 polyclonal antibody (Cat # PAB31552) shows strong nuclear positivity in fraction of cells in seminiferous ducts. -
Gene Info — DMRT1
Entrez GeneID
1761Protein Accession#
Q9Y5R6Gene Name
DMRT1
Gene Alias
DMT1
Gene Description
doublesex and mab-3 related transcription factor 1
Omim ID
602424Gene Ontology
HyperlinkGene Summary
This gene is found in a cluster with two other members of the gene family, having in common a zinc finger-like DNA-binding motif (DM domain). The DM domain is an ancient, conserved component of the vertebrate sex-determining pathway that is also a key regulator of male development in flies and nematodes. This gene exhibits a gonad-specific and sexually dimorphic expression pattern. Defective testicular development and XY feminization occur when this gene is hemizygous. [provided by RefSeq
Other Designations
DM domain expressed in testis 1|OTTHUMP00000020961
-
Interactome
-
Disease
-
Publication Reference
-
The human testis-specific proteome defined by transcriptomics and antibody-based profiling.
Djureinovic D, Fagerberg L, Hallstrom B, Danielsson A, Lindskog C, Uhlen M, Ponten F.
Molecular Human Reproduction 2014 Jun; 20(6):476.
Application：IHC, Human, Human testes.
-
Fibroblast growth factor receptor 3 is highly expressed in rarely dividing human type A spermatogonia.
von Kopylow K, Staege H, Schulze W, Will H, Kirchhoff C.
Histochemistry and Cell Biology 2012 Nov; 138(5):759.
Application：IF, IHC-P, Human, Human testis tissues.
-
Differential marker protein expression specifies rarefaction zone-containing human Adark spermatogonia.
von Kopylow K, Staege H, Spiess AN, Schulze W, Will H, Primig M, Kirchhoff C.
Reproduction 2012 Jan; 143(1):45.
Application：IF, IHC-P, Human, Human testes.
-
The human testis-specific proteome defined by transcriptomics and antibody-based profiling.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com