ICA1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western Blot analysis of Lane 1: RT-4 cell, Lane 2: U-251 MG sp cell, Lane 3: human plasma tissue (IgG/HSA depleted), Lane 4: human liver tissue and Lane 5: human tonsil tissue lysates with ICA1 polyclonal antibody (Cat # PAB31522).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human heart muscle with ICA1 polyclonal antibody (Cat # PAB31522) shows strong cytoplasmic positivity in myocytes.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human ICA1.
Immunogen
Recombinant protein corresponding to human ICA1.
Sequence
DELLDMKSEEGACLGPVAGTPEPEGADKDDLLLLSEIFNASSLEEGEFSKEWAAVFGDGQVKEPVPTMALGEPDPKAQTGSGFLPSQLLDQNMKDLQASLQEPAKAASDLTAWFSLFADLDPLSNPDAVGKTDKEHELL
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western Blot analysis of Lane 1: RT-4 cell, Lane 2: U-251 MG sp cell, Lane 3: human plasma tissue (IgG/HSA depleted), Lane 4: human liver tissue and Lane 5: human tonsil tissue lysates with ICA1 polyclonal antibody (Cat # PAB31522).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human heart muscle with ICA1 polyclonal antibody (Cat # PAB31522) shows strong cytoplasmic positivity in myocytes. -
Gene Info — ICA1
Entrez GeneID
3382Protein Accession#
Q05084Gene Name
ICA1
Gene Alias
ICA69, ICAp69
Gene Description
islet cell autoantigen 1, 69kDa
Omim ID
147625Gene Ontology
HyperlinkGene Summary
This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq
Other Designations
diabetes mellitus type I autoantigen|islet cell autoantigen 1|islet cell autoantigen 1 (69kD)|islet cell autoantigen 1 isoform|islet cell autoantigen p69
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells.
Charlotte Stadler, Elton Rexhepaj, Vasanth R Singan, Robert F Murphy, Rainer Pepperkok, Mathias Uhlén, Jeremy C Simpson, Emma Lundberg.
Nature Methods 2013 Apr; 10(4):315.
-
Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com