DKC1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human DKC1.
Immunogen
Recombinant protein corresponding to human DKC1.
Sequence
KERKSLPEEDVAEIQHAEEFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVEKTGHSGTL
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human gall bladder with DKC1 polyclonal antibody (Cat # PAB31503) shows distinct nuclear positivity in glandular cells. -
Gene Info — DKC1
Entrez GeneID
1736Protein Accession#
O60832Gene Name
DKC1
Gene Alias
CBF5, DKC, FLJ97620, NAP57, NOLA4, XAP101
Gene Description
dyskeratosis congenita 1, dyskerin
Gene Ontology
HyperlinkGene Summary
This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also include the NOLA1, 2 and 3 proteins. The protein encoded by this gene and the three NOLA proteins localize to the dense fibrillar components of nucleoli and to coiled (Cajal) bodies in the nucleus. Both 18S rRNA production and rRNA pseudouridylation are impaired if any one of the four proteins is depleted. These four H/ACA snoRNP proteins are also components of the telomerase complex. The protein encoded by this gene is related to the Saccharomyces cerevisiae Cbf5p and Drosophila melanogaster Nop60B proteins. The gene lies in a tail-to-tail orientation with the palmitoylated erythrocyte membrane protein gene and is transcribed in a telomere to centromere direction. Both nucleotide substitutions and single trinucleotide repeat polymorphisms have been found in this gene. Mutations in this gene cause X-linked dyskeratosis congenita, a disease resulting in reticulate skin pigmentation, mucosal leukoplakia, nail dystrophy, and progressive bone marrow failure in most cases. Mutations in this gene also cause Hoyeraal-Hreidarsson syndrome, which is a more severe form of dyskeratosis congenita. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
H/ACA ribonucleoprotein complex subunit 4|OTTHUMP00000026046|cbf5p homolog|dyskerin|nopp140-associated protein of 57 kDa|nucleolar protein family A member 4|snoRNP protein DKC1
-
Interactome
-
Disease
-
Publication Reference
-
snoRNPs Regulate Telomerase Activity in Neuroblastoma and Are Associated with Poor Prognosis.
von Stedingk K, Koster J, Piqueras M, Noguera R, Navarro S, Pahlman S, Versteeg R, Ora I, Gisselsson D, Lindgren D, Axelson H.
Translational Oncology 2013 Aug; 6(4):447.
Application:IHC-P, WB-Tr, Human, Human neuroblastoma, Human tissue microarray, SK-N-BE(2)C cells, SK-N-SH cells.
-
snoRNPs Regulate Telomerase Activity in Neuroblastoma and Are Associated with Poor Prognosis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com