PTGES polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human PTGES.
Immunogen
Recombinant protein corresponding to human PTGES.
Sequence
ITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAPRNDM
Host
Rabbit
Reactivity
Human, Mouse
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of A-549 cell lysate with PTGES polyclonal antibody (Cat # PAB31502).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human placenta with PTGES polyclonal antibody (Cat # PAB31502) shows cytoplasmic positivity in a subset of trophoblastic cells.Immunofluorescence
Immunofluorescent staining of SiHa cells with PTGES polyclonal antibody (Cat # PAB31502) (Green) shows localization to endoplasmic reticulum. -
Gene Info — PTGES
Entrez GeneID
9536Protein Accession#
O14684Gene Name
PTGES
Gene Alias
MGC10317, MGST-IV, MGST1-L1, MGST1L1, MPGES, PGES, PIG12, PP102, PP1294, TP53I12, mPGES-1
Gene Description
prostaglandin E synthase
Omim ID
605172Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a glutathione-dependent prostaglandin E synthase. The expression of this gene has been shown to be induced by proinflammatory cytokine interleukin 1 beta (IL1B). Its expression can also be induced by tumor suppressor protein TP53, and may be involved in TP53 induced apoptosis. Knockout studies in mice suggest that this gene may contribute to the pathogenesis of collagen-induced arthritis and mediate acute pain during inflammatory responses. [provided by RefSeq
Other Designations
MGST1-like 1|OTTHUMP00000022345|glutathione S-transferase 1-like 1|microsomal glutathione S-transferase 1-like 1|microsomal prostaglandin E synthase-1|p53-induced apoptosis protein 12|p53-induced gene 12|tumor protein p53 inducible protein 12
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Active smoking increases microsomal PGE2-synthase-1/PGE-receptor-4 axis in human abdominal aortic aneurysms.
Dilmé JF, Solà-Villà D, Bellmunt S, Romero JM, Escudero JR, Camacho M, Vila L.
Mediators of inflammation 2014 Apr; 2014:316150.
Application:IHC, Human, Aorta.
-
Microvascular COX-2/mPGES-1/EP-4 axis in human abdominal aortic aneurysm.
Camacho M, Dilmé J, Solà-Villà D, Rodríguez C, Bellmunt S, Siguero L, Alcolea S, Romero JM, Escudero JR, Martínez-González J, Vila L.
Journal of Lipid Research 2013 Dec; 54(12):3506.
Application:IF, IHC-P, Human, Human abdominal aortic aneurysm, Human microvascular endothelial cells.
-
Active smoking increases microsomal PGE2-synthase-1/PGE-receptor-4 axis in human abdominal aortic aneurysms.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com