Product Browser

Last updated: 2018/1/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NLRP12 polyclonal antibody

  • Catalog # : PAB31495
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant human NLRP12.
  • Immunogen:
  • Recombinant protein corresponding to human NLRP12.
  • Sequence:
  • LKRCRSAQVLHLYGATYSADGEDRARCSAGAHTLLVQLPERTVLLDAYSEHLAAALCTNPNLIELSLYRNALGS
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human bone marrow with NLRP12 polyclonal antibody (Cat # PAB31495) shows cytoplasmic positivity in hematopoietic cells.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • NLRP12
  • Gene Alias:
  • CLR19.3,FCAS2,NALP12,PAN6,PYPAF7,RNO,RNO2
  • Gene Description:
  • NLR family, pyrin domain containing 12
  • Gene Summary:
  • This gene encodes a member of the CATERPILLER family of cytoplasmic proteins. The encoded protein, which contains an N-terminal pyrin domain, a NACHT domain, a NACHT-associated domain, and a C-terminus leucine-rich repeat region, functions as an attenuating factor of inflammation by suppressing inflammatory responses in activated monocytes. Alternatively spliced transcript variants encoding distinct isoforms have been described but the full-length nature of some of these has not been determined. [provided by RefSeq
  • Other Designations:
  • NACHT, LRR and PYD containing protein 12,NACHT, leucine rich repeat and PYD containing 12,OTTHUMP00000067226,PYRIN-containing APAF1-like protein 7,monarch 1,nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domain containing 12,regu
  • RSS
  • YouTube
  • Linkedin
  • Facebook