CAMKK2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human CAMKK2.
Immunogen
Recombinant protein corresponding to amino acids 2-137 of human CAMKK2.
Sequence
SSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDTSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSPVSSPQSS
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Tissue lysate)
Western Blot analysis of human cerebral cortex tissue.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.Immunofluorescence
Immunofluorescent staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green. -
Gene Info — CAMKK2
Entrez GeneID
10645Protein Accession#
Q96RR4Gene Name
CAMKK2
Gene Alias
CAMKK, CAMKKB, KIAA0787, MGC15254
Gene Description
calcium/calmodulin-dependent protein kinase kinase 2, beta
Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This protein plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade by phosphorylating the downstream kinases CaMK1 and CaMK4. Seven transcript variants encoding six distinct isoforms have been identified for this gene. Additional splice variants have been described but their full-length nature has not been determined. The identified isoforms exhibit a distinct ability to undergo autophosphorylation and to phosphorylate the downstream kinases. [provided by RefSeq
Other Designations
CAMKK beta protein|calcium/calmodulin-dependent protein kinase beta|calcium/calmodulin-dependent protein kinase kinase 2 beta
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
c-Myc Antagonises the Transcriptional Activity of the Androgen Receptor in Prostate Cancer Affecting Key Gene Networks.
Barfeld SJ, Urbanucci A, Itkonen HM, Fazli L, Hicks JL, Thiede B, Rennie PS, Yegnasubramanian S, DeMarzo AM, Mills IG.
EbioMedicine 2017 Apr; 18:83.
Application:WB-Tr, Human, LNCaP cells.
-
Role of Ca(2+)/calmodulin-dependent protein kinase kinase in adrenal aldosterone production.
Nanba K, Chen A, Nishimoto K, Rainey WE.
Endocrinology 2015 May; 156(5):1750.
Application:IHC-P, Human, Human adrenal cortex.
-
Calcium calmodulin dependent kinase kinase 2 - a novel therapeutic target for gastric adenocarcinoma.
Subbannayya Y, Syed N, Barbhuiya MA, Raja R, Marimuthu A, Sahasrabuddhe N, Pinto SM, Manda SS, Renuse S, Manju HC, Zameer MA, Sharma J, Brait M, Srikumar K, Roa JC, Vijaya Kumar M, Kumar KV, Prasad TS, Ramaswamy G, Kumar RV, Pandey A, Gowda H, Chatterjee A.
Cancer Biology & Therapy 2015 Jan; 16(2):336.
Application:IHC-P, WB-Ce, WB-Tr, Human, AGS cells, NCI-N87 cells, Human gastric tumor tissues, Human tissue microarray, KATO-III cells, SNU-16 cells.
-
The androgen receptor fuels prostate cancer by regulating central metabolism and biosynthesis.
Massie CE, Lynch A, Ramos-Montoya A, Boren J, Stark R, Fazli L, Warren A, Scott H, Madhu B, Sharma N, Bon H, Zecchini V, Smith DM, Denicola GM, Mathews N, Osborne M, Hadfield J, Macarthur S, Adryan B, Lyons SK, Brindle KM, Griffiths J, Gleave ME, Rennie PS, Neal DE, Mills IG.
The EMBO Journal 2011 May; 30(13):2719.
Application:IHC-P, WB-Ce, WB-Tr, Human, 22Rv1 cells, C4-2B cells, DU 145 cells, Human prostate cancer, Human tissue microarray, LNCaP cells, PC-3 cells, PNT1A cells.
-
c-Myc Antagonises the Transcriptional Activity of the Androgen Receptor in Prostate Cancer Affecting Key Gene Networks.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com