DLC1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells) and Lane 2: NBT-II cell lysate (Wistar rat bladder tumour cells) with DLC1 polyclonal antibody (Cat # PAB31477).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human duodenum with DLC1 polyclonal antibody (Cat # PAB31477) shows distinct positivity of microvilli in glandular cells.
Immunofluorescence
Immunofluorescent staining of U-251 MG cells with DLC1 polyclonal antibody (Cat # PAB31477) (Green) shows localization to nucleoplasm and vesicles.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human DLC1.
Immunogen
Recombinant protein corresponding to human DLC1.
Sequence
RSWEEHVTHWMGQPFNSDDRNTACHHGLVADSLQASMEKDATLNVDRKEKCVSLPDCCHGSELRDFPGRPMGHLSKDVDENDSHEGEDQFLSLEASTETLVHVSDEDNNADLCLTDDKQVLNTQGQ
Host
Rabbit
Reactivity
Human, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:2500-1:5000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells) and Lane 2: NBT-II cell lysate (Wistar rat bladder tumour cells) with DLC1 polyclonal antibody (Cat # PAB31477).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human duodenum with DLC1 polyclonal antibody (Cat # PAB31477) shows distinct positivity of microvilli in glandular cells.Immunofluorescence
Immunofluorescent staining of U-251 MG cells with DLC1 polyclonal antibody (Cat # PAB31477) (Green) shows localization to nucleoplasm and vesicles. -
Gene Info — DLC1
Entrez GeneID
10395Protein Accession#
Q96QB1Gene Name
DLC1
Gene Alias
ARHGAP7, FLJ21120, HP, STARD12, p122-RhoGAP
Gene Description
deleted in liver cancer 1
Omim ID
604258Gene Ontology
HyperlinkGene Summary
This gene is deleted in the primary tumor of hepatocellular carcinoma. It maps to 8p22-p21.3, a region frequently deleted in solid tumors. It is suggested that this gene is a candidate tumor suppressor gene for human liver cancer, as well as for prostate, lung, colorectal, and breast cancers. Alternative splicing at this locus results in several transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
OTTHUMP00000116050|Rho-GTPase-activating protein 7|START domain containing protein 12|StAR-related lipid transfer (START) domain containing 12|StAR-related lipid transfer protein 12|deleted in liver cancer 1 variant 2
-
Interactome
-
Disease
-
Publication Reference
-
The transcriptional coactivators megakaryoblastic leukemia 1/2 mediate the effects of loss of the tumor suppressor deleted in liver cancer 1.
Muehlich S, Hampl V, Khalid S, Singer S, Frank N, Breuhahn K, Gudermann T, Prywes R.
Oncogene 2012 Aug; 31(35):3913.
Application：IHC-P, WB-Ce, WB-Tr, Human, HCC1143, Hep3B, HepG2, Human hepatocellular carcinoma, Huh7, MCF7, MCF10F, MDA-MB-453, MDA-MB-465 cells.
-
The transcriptional coactivators megakaryoblastic leukemia 1/2 mediate the effects of loss of the tumor suppressor deleted in liver cancer 1.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com