DEFA5 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
Western Blot analysis of human small intestine tissue lysate with DEFA5 polyclonal antibody (Cat # PAB31461).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human small intestine with DEFA5 polyclonal antibody (Cat # PAB31461) shows strong cytoplasmic positivity in Paneth cells.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human DEFA5.
Immunogen
Recombinant protein corresponding to human DEFA5.
Sequence
ESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTGRCATRESLSGVCEISGRLYRLCCR
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Tissue lysate)
Western Blot analysis of human small intestine tissue lysate with DEFA5 polyclonal antibody (Cat # PAB31461).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human small intestine with DEFA5 polyclonal antibody (Cat # PAB31461) shows strong cytoplasmic positivity in Paneth cells. -
Gene Info — DEFA5
Entrez GeneID
1670Protein Accession#
Q01523Gene Name
DEFA5
Gene Alias
DEF5, HD-5, MGC129728
Gene Description
defensin, alpha 5, Paneth cell-specific
Omim ID
600472Gene Ontology
HyperlinkGene Summary
Defensins are a family of microbicidal and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several of the alpha defensin genes appear to be clustered on chromosome 8. The protein encoded by this gene, defensin, alpha 5, is highly expressed in the secretory granules of Paneth cells of the ileum. [provided by RefSeq
Other Designations
defensin 5|defensin, alpha 5|defensin, alpha 5, preproprotein
-
Interactome
-
Disease
-
Publication Reference
-
Gene expression profiling of metaplastic lineages identifies CDH17 as a prognostic marker in early stage gastric cancer.
Lee HJ, Nam KT, Park HS, Kim MA, Lafleur BJ, Aburatani H, Yang HK, Kim WH, Goldenring JR.
Gastroenterology 2010 Jul; 139(1):213.
Application：IHC-P, Human, Human gastric cancer, Human stomach, Human tissue microarray.
-
Gene expression profiling of metaplastic lineages identifies CDH17 as a prognostic marker in early stage gastric cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com