Product Browser

Last updated: 2018/1/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BNIP3L polyclonal antibody

  • Catalog # : PAB31456
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant human BNIP3L.
  • Immunogen:
  • Recombinant protein corresponding to human BNIP3L.
  • Sequence:
  • SNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSSRPENIPPKEFHFRHPKRSVSLSMRKSGAMK
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/mL)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Publication Reference
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human epididymis with BNIP3L polyclonal antibody (Cat # PAB31456) shows strong cytoplasmic positivity.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of U-2 OS cells with BNIP3L polyclonal antibody (Cat # PAB31456) (Green) shows localization to nuclear speckles and mitochondria.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 665
  • Gene Name:
  • BNIP3L
  • Gene Alias:
  • BNIP3a,NIX
  • Gene Description:
  • BCL2/adenovirus E1B 19kDa interacting protein 3-like
  • Gene Summary:
  • This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein which is responsible for the protection of virally-induced cell death, as well as E1B 19 kDa-like sequences of BCL2, also an apoptotic protector. The protein encoded by this gene is a functional homolog of BNIP3, a proapoptotic protein. This protein may function simultaneously with BNIP3 and may play a role in tumor suppression. [provided by RefSeq
  • Other Designations:
  • BCL2/adenovirus E1B 19-kd protein-interacting protein 3a,BCL2/adenovirus E1B 19kD-interacting protein 3-like,adenovirus E1B19k-binding protein B5
  • RSS
  • YouTube
  • Linkedin
  • Facebook