ALDH3A2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western Blot analysis of Lane 1: RT-4 cell, Lane 2: U-251 MG sp cell, Lane 3: human plasma tissue (IgG/HSA depleted) and Lane 4: human liver tissue lysates with ALDH3A2 polyclonal antibody (Cat # PAB31451).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human adrenal gland with ALDH3A2 polyclonal antibody (Cat # PAB31451) shows strong cytoplasmic positivity in cortical cells.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human ALDH3A2.
Immunogen
Recombinant protein corresponding to human ALDH3A2.
Sequence
SHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDTFSHQRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFLLKRFNKE
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western Blot analysis of Lane 1: RT-4 cell, Lane 2: U-251 MG sp cell, Lane 3: human plasma tissue (IgG/HSA depleted) and Lane 4: human liver tissue lysates with ALDH3A2 polyclonal antibody (Cat # PAB31451).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human adrenal gland with ALDH3A2 polyclonal antibody (Cat # PAB31451) shows strong cytoplasmic positivity in cortical cells. -
Gene Info — ALDH3A2
Entrez GeneID
224Protein Accession#
P51648Gene Name
ALDH3A2
Gene Alias
ALDH10, DKFZp686E23276, FALDH, FLJ20851, SLS
Gene Description
aldehyde dehydrogenase 3 family, member A2
Gene Ontology
HyperlinkGene Summary
Aldehyde dehydrogenase isozymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. This gene product catalyzes the oxidation of long-chain aliphatic aldehydes to fatty acid. Mutations in the gene cause Sjogren-Larsson syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000065801|aldehyde dehydrogenase 10|aldehyde dehydrogenase 3A2|fatty aldehyde dehydrogenase
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Comparative analysis of proteome and transcriptome variation in mouse.
Ghazalpour A, Bennett B, Petyuk VA, Orozco L, Hagopian R, Mungrue IN, Farber CR, Sinsheimer J, Kang HM, Furlotte N, Park CC, Wen PZ, Brewer H, Weitz K, Camp DG II, Pan C, Yordanova R, Neuhaus I, Tilford C, Siemers N, Gargalovic P, Eskin E, Kirchgessner T, Smith DJ, Smith RD, Lusis AJ.
PLoS Genetics 2011 Jun; 7(6):e1001393.
Application：WB-Ce, Mouse, Liver.
-
Comparative analysis of proteome and transcriptome variation in mouse.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com