CST3 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human CST3.
Immunogen
Recombinant protein corresponding to human CST3.
Sequence
SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of HepG2 cell lysate with CST3 polyclonal antibody (Cat # PAB31437).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human salivary gland with CST3 polyclonal antibody (Cat # PAB31437) shows strong cytoplasmic positivity in glandular cells.Immunofluorescence
Immunofluorescent staining of U-251 MG cells with CST3 polyclonal antibody (Cat # PAB31437) (Green) shows localization to the Golgi apparatus and vesicles. -
Gene Info — CST3
Entrez GeneID
1471Protein Accession#
P01034Gene Name
CST3
Gene Alias
ARMD11, MGC117328
Gene Description
cystatin C
Gene Ontology
HyperlinkGene Summary
The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes the most abundant extracellular inhibitor of cysteine proteases, which is found in high concentrations in biological fluids and is expressed in virtually all organs of the body. A mutation in this gene has been associated with amyloid angiopathy. Expression of this protein in vascular wall smooth muscle cells is severely reduced in both atherosclerotic and aneurysmal aortic lesions, establishing its role in vascular disease. [provided by RefSeq
Other Designations
OTTHUMP00000030440|OTTHUMP00000164181|OTTHUMP00000164182|bA218C14.4 (cystatin C)|cystatin 3|cystatin C (amyloid angiopathy and cerebral hemorrhage)|gamma-trace|neuroendocrine basic polypeptide|post-gamma-globulin
-
Interactome
-
Disease
-
Publication Reference
-
Candidate serological biomarkers for cancer identified from the secretomes of 23 cancer cell lines and the human protein atlas.
Wu CC, Hsu CW, Chen CD, Yu CJ, Chang KP, Tai DI, Liu HP, Su WH, Chang YS, Yu JS.
Molecular & Cellular Proteomics 2010 Jun; 9(6):1100.
Application:IHC, Human, Colon, Liver, Bladder, Breast, Lung cancer.
-
Candidate serological biomarkers for cancer identified from the secretomes of 23 cancer cell lines and the human protein atlas.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com