ACSL3 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with ACSL3 polyclonal antibody (Cat # PAB31428).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach with ACSL3 polyclonal antibody (Cat # PAB31428) shows strong cytoplasmic positivity in glandular cells.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human ACSL3.
Immunogen
Recombinant protein corresponding to human ACSL3.
Sequence
MYNFQLVTLYATLGGPAIVHALNETEVTNIITSKELLQTKLKDIVSLVPRLRHIITVDGKPPTWSEFPKGIIVHTMAAVEALGAKASMENQPHSKPLPSDIAVIM
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with ACSL3 polyclonal antibody (Cat # PAB31428).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach with ACSL3 polyclonal antibody (Cat # PAB31428) shows strong cytoplasmic positivity in glandular cells. -
Gene Info — ACSL3
Entrez GeneID
2181Protein Accession#
O95573Gene Name
ACSL3
Gene Alias
ACS3, FACL3, PRO2194
Gene Description
acyl-CoA synthetase long-chain family member 3
Omim ID
602371Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in brain, and preferentially utilizes myristate, arachidonate, and eicosapentaenoate as substrates. The amino acid sequence of this isozyme is 92% identical to that of rat homolog. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000164212|fatty-acid-Coenzyme A ligase, long-chain 3|lignoceroyl-CoA synthase
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com