GDF15 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human GDF15.
Immunogen
Recombinant protein corresponding to human GDF15.
Sequence
LSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQL
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of BEWO cells with GDF15 polyclonal antibody (Cat # PAB31426).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human placenta with GDF15 polyclonal antibody (Cat # PAB31426) shows strong cytoplasmic positivity in trophoblastic cells.Immunofluorescence
Immunofluorescent staining of HepG2 cells with GDF15 polyclonal antibody (Cat # PAB31426) (Green) shows localization to the Golgi apparatus. -
Gene Info — GDF15
Entrez GeneID
9518Protein Accession#
Q99988Gene Name
GDF15
Gene Alias
GDF-15, MIC-1, MIC1, NAG-1, PDF, PLAB, PTGFB
Gene Description
growth differentiation factor 15
Omim ID
605312Gene Ontology
HyperlinkGene Summary
Bone morphogenetic proteins (e.g., BMP5; MIM 112265) are members of the transforming growth factor-beta (see TGFB1; MIM 190180) superfamily and regulate tissue differentiation and maintenance. They are synthesized as precursor molecules that are processed at a dibasic cleavage site to release C-terminal domains containing a characteristic motif of 7 conserved cysteines in the mature protein.[supplied by OMIM
Other Designations
NSAID (nonsteroidal anti-inflammatory drug)-activated protein 1|PTGF-beta|prostate differentiation factor
-
Interactome
-
Disease
-
Publication Reference
-
Visfatin Mediates Malignant Behaviors through Adipose-Derived Stem Cells Intermediary in Breast Cancer.
Huang JY, Wang YY, Lo S, Tseng LM, Chen DR, Wu YC, Hou MF, Yuan SF.
Cancers 2019 Dec; 12(1):E29.
Application:IHC, WB, Human, ADSCs, Human breast cancer, MDA-MB-231 cells.
-
Combined Secretomics and Transcriptomics Revealed Cancer-Derived GDF15 is Involved in Diffuse-Type Gastric Cancer Progression and Fibroblast Activation.
Ishige T, Nishimura M, Satoh M, Fujimoto M, Fukuyo M, Semba T, Kado S, Tsuchida S, Sawai S, Matsushita K, Togawa A, Matsubara H, Kaneda A, Nomura F.
Scientific Reports 2016 Feb; 2:21681.
Application:IHC-P, WB-Ce, Human, Human stomach tissue array, KATO-III, MKN-7, MKN-45, MKN-74, NUGC-4, OCUM-1 cells.
-
The role of growth differentiation factor 15 in the pathogenesis of primary myelofibrosis.
Uchiyama T, Kawabata H, Miura Y, Yoshioka S, Iwasa M, Yao H, Sakamoto S, Fujimoto M, Haga H, Kadowaki N, Maekawa T, Takaori-Kondo A.
Cancer Medicine 2015 Oct; 4(10):1558.
Application:IHC-P, Human, Human bone marrow.
-
Reconstitution of TGFBR2-Mediated Signaling Causes Upregulation of GDF-15 in HCT116 Colorectal Cancer Cells.
Lee J, Fricke F, Warnken U, Schnölzer M, Kopitz J, Gebert J.
PLoS One 2015 Jun; 10(6):e0131506.
Application:IP, WB-Tr, Human, HCT-116 cells.
-
Association of serum level of growth differentiation factor 15 with liver cirrhosis and hepatocellular carcinoma.
Liu X, Chi X, Gong Q, Gao L, Niu Y, Chi X, Cheng M, Si Y, Wang M, Zhong J, Niu J, Yang W.
PLoS One 2015 May; 10(5):e0127518.
Application:ELISA, IHC-P, WB-Ti, Human, Human hepatocellular carcinoma, Human serum.
-
GDF15 derived from both tumor-associated macrophages and esophageal squamous cell carcinomas contributes to tumor progression via Akt and Erk pathways.
Urakawa N, Utsunomiya S, Nishio M, Shigeoka M, Takase N, Arai N, Kakeji Y, Koma Y, Yokozaki H.
Laboratory Investigation 2015 May; 95(5):491.
Application:IF, IHC-P, Human, Human esophageal squamous cell carcinomas, Human macrophages, TE-9CM cells.
-
GDF-15 is abundantly expressed in plexiform lesions in patients with pulmonary arterial hypertension and affects proliferation and apoptosis of pulmonary endothelial cells.
Nickel N, Jonigk D, Kempf T, Bockmeyer CL, Maegel L, Rische J, Laenger F, Lehmann U, Sauer C, Greer M, Welte T, Hoeper MM, Golpon HA.
Respiratory Research 2011 May; 12(1):62.
Application:IHC-P, Human, Human lung.
-
Growth differentiation factor 15: a prognostic marker for recurrence in colorectal cancer.
Wallin U, Glimelius B, Jirström K, Darmanis S, Nong RY, Ponten F, Johansson C, Pahlman L, Birgisson H.
British Journal of Cancer 2011 May; 104(10):1619.
Application:IF, IHC-P, Human, Human colorectal cancer, Human tissue microarray.
-
GDF-15 contributes to proliferation and immune escape of malignant gliomas.
Roth P, Junker M, Tritschler I, Mittelbronn M, Dombrowski Y, Breit SN, Tabatabai G, Wick W, Weller M, Wischhusen J.
Clinical Cancer Research 2010 Aug; 16(15):3851.
Application:IHC-P, Human, Human gliomas.
-
Primary ovarian mucinous carcinoma of intestinal type: significance of pattern of invasion and immunohistochemical expression profile in a series of 31 cases.
Tabrizi AD, Kalloger SE, Köbel M, Cipollone J, Roskelley CD, Mehl E, Gilks CB.
International Journal of Gynecological Pathology 2010 Mar; 29(2):99.
Application:IHC, Human, Human tissue microarray.
-
Visfatin Mediates Malignant Behaviors through Adipose-Derived Stem Cells Intermediary in Breast Cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com