SIRT2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human SIRT2.
Immunogen
Recombinant protein corresponding to human SIRT2.
Sequence
KDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLL
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with SIRT2 polyclonal antibody (Cat # PAB31424).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with SIRT2 polyclonal antibody (Cat # PAB31424) shows cytoplasmic positivity in nerve fibers.Immunofluorescence
Immunofluorescent staining of U-251 MG cells with SIRT2 polyclonal antibody (Cat # PAB31424) (Green) shows localization to plasma membrane and cytosol. -
Gene Info — SIRT2
Entrez GeneID
22933Protein Accession#
Q8IXJ6Gene Name
SIRT2
Gene Alias
SIR2, SIR2L, SIR2L2
Gene Description
sirtuin (silent mating type information regulation 2 homolog) 2 (S. cerevisiae)
Omim ID
604480Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Two transcript variants result from alternative splicing of this gene. [provided by RefSeq
Other Designations
silencing information regulator 2-like|silent information regulator 2|sir2-related protein type 2|sirtuin 2|sirtuin type 2
-
Interactome
-
Publication Reference
-
A chromatin modifier genetic screen identifies SIRT2 as a modulator of response to targeted therapies through the regulation of MEK kinase activity.
Bajpe PK, Prahallad A, Horlings H, Nagtegaal I, Beijersbergen R, Bernards R.
Oncogene 2015 Jan; 34(4):531.
Application:WB-Tr, Human, A-375, Difi, HCA-7, PC-9 cells.
-
A chromatin modifier genetic screen identifies SIRT2 as a modulator of response to targeted therapies through the regulation of MEK kinase activity.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com