PTGER3 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with PTGER3 polyclonal antibody (Cat # PAB31423).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human smooth muscle with PTGER3 polyclonal antibody (Cat # PAB31423) shows moderate cytoplasmic positivity in smooth muscle cells.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human PTGER3.
Immunogen
Recombinant protein corresponding to human PTGER3.
Sequence
MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVS
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with PTGER3 polyclonal antibody (Cat # PAB31423).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human smooth muscle with PTGER3 polyclonal antibody (Cat # PAB31423) shows moderate cytoplasmic positivity in smooth muscle cells. -
Gene Info — PTGER3
Entrez GeneID
5733Protein Accession#
P43115Gene Name
PTGER3
Gene Alias
EP3, EP3-I, EP3-II, EP3-III, EP3-IV, EP3e, MGC141828, MGC141829, MGC27302
Gene Description
prostaglandin E receptor 3 (subtype EP3)
Omim ID
176806Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor may have many biological functions, which involve digestion, nervous system, kidney reabsorption, and uterine contraction activities. Studies of the mouse counterpart suggest that this receptor may also mediate adrenocorticotropic hormone response as well as fever generation in response to exogenous and endogenous stimuli. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000011033|OTTHUMP00000011034|OTTHUMP00000011035|PGE receptor, EP3 subtype|prostaglandin E receotor EP3 subtype 3 isoform|prostaglandin E receptor 3, subtype EP3|prostaglandin E2 receptor|prostaglandin receptor (PGE-2)|prostanoid EP3 receptor
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Identification of prostaglandin receptors in human ureters.
Oll M, Baumann C, Behbahani TE, von Ruecker A, Müller SC, Ellinger J.
BMC Urology 2012 Dec; 12:35.
Application：IHC-P, Human, Human ureter and renal pelvis.
-
Identification of prostaglandin receptors in human ureters.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com