ANXA6 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human ANXA6.
Immunogen
Recombinant protein corresponding to human ANXA6.
Sequence
IADTPSGDKTSLETRFMTILCTRSYPHLRRVFQEFIKMTNYDVEHTIKKEMSGDVRDAFVAIVQSVKNKPLFFADKLYKSMKGAGTDEKTLTRIMVSRSEIDLLNIRREFIEKYDKSLHQAIEGDTSGDFLKALLALCGGED
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells) and Lane 2: NBT-II cell lysate (Wistar rat bladder tumour cells) with ANXA6 polyclonal antibody (Cat # PAB31417).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human appendix with ANXA6 polyclonal antibody (Cat # PAB31417) shows cytoplasmic positivity in lymphoid tissue. -
Gene Info — ANXA6
Entrez GeneID
309Protein Accession#
P08133Gene Name
ANXA6
Gene Alias
ANX6, CBP68
Gene Description
annexin A6
Omim ID
114070Gene Ontology
HyperlinkGene Summary
Annexin VI belongs to a family of calcium-dependent membrane and phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. The annexin VI gene is approximately 60 kbp long and contains 26 exons. It encodes a protein of about 68 kDa that consists of eight 68-amino acid repeats separated by linking sequences of variable lengths. It is highly similar to human annexins I and II sequences, each of which contain four such repeats. Exon 21 of annexin VI is alternatively spliced, giving rise to two isoforms that differ by a 6-amino acid insertion at the start of the seventh repeat. Annexin VI has been implicated in mediating the endosome aggregation and vesicle fusion in secreting epithelia during exocytosis. [provided by RefSeq
Other Designations
annexin VI|annexin VI (p68)|calcium-binding protein p68|calelectrin|calphobindin II
-
Interactome
-
Disease
-
Publication Reference
-
Comparative study of human and mouse postsynaptic proteomes finds high compositional conservation and abundance differences for key synaptic proteins.
Bayes A, Collins MO, Croning MD, van de Lagemaat LN, Choudhary JS, Grant SG.
PLoS One 2012 Oct; 7(10):e4668.
Application:WB-Ti, Human, Mouse, Human brain, Mouse brain.
-
Cell surface annexins regulate ADAM-mediated ectodomain shedding of proamphiregulin.
Nakayama H, Fukuda S, Inoue H, Nishida-Fukuda H, Shirakata Y, Hashimoto K, Higashiyama S.
Molecular Biology of the Cell 2012 May; 23(10):1694.
Application:WB-Tr, Human, HT-1080 cells.
-
Comparative study of human and mouse postsynaptic proteomes finds high compositional conservation and abundance differences for key synaptic proteins.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com