Product Browser

Last updated: 2017/12/10

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ITGB2 polyclonal antibody

  • Catalog # : PAB31410
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant human ITGB2.
  • Immunogen:
  • Recombinant protein corresponding to human ITGB2.
  • Sequence:
  • CTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSML
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
    Western Blot (1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot
  • Western Blot
  • Western Blot analysis of Lane 1: RT-4 cell, Lane 2: U-251 MG sp cell, Lane 3: human plasma tissue (IgG/HSA depleted), Lane 4: human liver tissue and Lane 5: human tonsil tissue lysates with ITGB2 polyclonal antibody (Cat # PAB31410).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human spleen with ITGB2 polyclonal antibody (Cat # PAB31410) shows strong cytoplasmic positivity in cells in red pulp.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 3689
  • Gene Name:
  • ITGB2
  • Gene Alias:
  • CD18,LAD,LCAMB,LFA-1,MAC-1,MF17,MFI7
  • Gene Description:
  • integrin, beta 2 (complement component 3 receptor 3 and 4 subunit)
  • Gene Summary:
  • The product of this gene belongs to the integrin beta chain family of proteins. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. This gene encodes the integrin beta chain beta 2. A given chain may combine with multiple partners resulting in different integrins. For example, beta 2 combines with the alpha L chain to form the integrin LFA-1, and combines with the alpha M chain to form the integrin Mac-1. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling. Defects in this gene are the cause of leukocyte adhesion deficiency type I (LAD1). Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • CD18 subunit,OTTHUMP00000115278,OTTHUMP00000115279,OTTHUMP00000115281,OTTHUMP00000115282,beta 2 integrin subunit,cell surface adhesion glycoprotein LFA-1/CR3/P150,959 beta subunit precursor),complement receptor C3 beta-subunit,integrin beta 2,integrin bet
  • RSS
  • YouTube
  • Linkedin
  • Facebook