NFATC2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
Western Blot analysis of human liver tissue lysate with NFATC2 polyclonal antibody (Cat # PAB31405).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lymph node with NFATC2 polyclonal antibody (Cat # PAB31405) shows strong cytoplasmic positivity in germinal center cells and non-germinal center cells.
Immunofluorescence
Immunofluorescent staining of U-251 MG cells with NFATC2 polyclonal antibody (Cat # PAB31405) (Green) shows localization to nucleoplasm and cytosol.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human NFATC2.
Immunogen
Recombinant protein corresponding to human NFATC2.
Sequence
DFSILFDYEYLNPNEEEPNAHKVASPPSGPAYPDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPV
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Tissue lysate)
Western Blot analysis of human liver tissue lysate with NFATC2 polyclonal antibody (Cat # PAB31405).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lymph node with NFATC2 polyclonal antibody (Cat # PAB31405) shows strong cytoplasmic positivity in germinal center cells and non-germinal center cells.Immunofluorescence
Immunofluorescent staining of U-251 MG cells with NFATC2 polyclonal antibody (Cat # PAB31405) (Green) shows localization to nucleoplasm and cytosol. -
Gene Info — NFATC2
Entrez GeneID
4773Protein Accession#
Q13469Gene Name
NFATC2
Gene Alias
KIAA0611, NFAT1, NFATP
Gene Description
nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2
Omim ID
600490Gene Ontology
HyperlinkGene Summary
This gene is a member of the nuclear factor of activated T cells (NFAT) family. The product of this gene is a DNA-binding protein with a REL-homology region (RHR) and an NFAT-homology region (NHR). This protein is present in the cytosol and only translocates to the nucleus upon T cell receptor (TCR) stimulation, where it becomes a member of the nuclear factors of activated T cells transcription complex. This complex plays a central role in inducing gene transcription during the immune response. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
Other Designations
NFAT pre-existing subunit|NFAT transcription complex, preexisting component|OTTHUMP00000031291|T cell transcription factor NFAT1|nuclear factor of activated T-cells, cytoplasmic 2|nuclear factor of activated T-cells, preexisting component|preexisting nucl
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Galanin modulates the neural niche to favour perineural invasion in head and neck cancer.
Scanlon CS, Banerjee R, Inglehart RC, Liu M, Russo N, Hariharan A, van Tubergen EA, Corson SL, Asangani IA, Mistretta CM, Chinnaiyan AM, D' Silva NJ.
Nature Communications 2015 Apr; 6:6885.
Application：WB-Ce, WB-Tr, Human, HOK, OSCC3, UM-SCC cells.
-
The calcineurin/NFAT pathway is activated in diagnostic breast cancer cases and is essential to survival and metastasis of mammary cancer cells.
Quang CT, Leboucher S, Passaro D, Fuhrmann L, Nourieh M, Vincent-Salomon A, Ghysdael J.
Cell Death & Disease 2015 Feb; 6(2):e1658.
Application：ChIP, IHC-P, WB-Tr, Human, Mouse, 4T1 cells, Human breast cancer, Human tissue microarray, Mouse tumors.
-
Galanin modulates the neural niche to favour perineural invasion in head and neck cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com