MMP3 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human MMP3.
Immunogen
Recombinant protein corresponding to human MMP3.
Sequence
MYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAI
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of U-87 MG cell lysate with MMP3 polyclonal antibody (Cat # PAB31395).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lymph node with MMP3 polyclonal antibody (Cat # PAB31395) shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra. -
Gene Info — MMP3
Entrez GeneID
4314Protein Accession#
P08254Gene Name
MMP3
Gene Alias
CHDS6, MGC126102, MGC126103, MGC126104, MMP-3, SL-1, STMY, STMY1, STR1
Gene Description
matrix metallopeptidase 3 (stromelysin 1, progelatinase)
Omim ID
185250Gene Ontology
HyperlinkGene Summary
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene encodes an enzyme which degrades fibronectin, laminin, collagens III, IV, IX, and X, and cartilage proteoglycans. The enzyme is thought to be involved in wound repair, progression of atherosclerosis, and tumor initiation. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3. [provided by RefSeq
Other Designations
matrix metalloproteinase 3|matrix metalloproteinase 3 (stromelysin 1, progelatinase)|progelatinase|proteoglycanase|stromelysin 1|transin-1
-
Interactome
-
Disease
-
Publication Reference
-
Automated Learning of Subcellular Variation among Punctate Protein Patterns and a Generative Model of Their Relation to Microtubules.
Johnson GR, Li J, Shariff A, Rohde GK, Murphy RF.
PLoS computational biology 2015 Dec; 11(12):e1004614.
Application:IF, Human, A-431, U-2 OS, U-251 MG cells.
-
Tumor necrosis factor-α-accelerated degradation of type I collagen in human skin is associated with elevated matrix metalloproteinase (MMP)-1 and MMP-3 ex vivo.
Ågren MS, Schnabel R, Christensen LH, Mirastschijski U.
European Journal of Cell Biology 2015 Jan; 94(1):12.
Application:WB, Human, Skin explants.
-
Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model.
Kato BS, Nicholson G, Neiman M, Rantalainen M, Holmes CC, Barrett A, Uhlén M, Nilsson P, Spector TD, Schwenk JM.
Proteome Science 2011 Nov; 9:73.
Application:Array, Recombinant protein.
-
Automated Learning of Subcellular Variation among Punctate Protein Patterns and a Generative Model of Their Relation to Microtubules.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com