STK3 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells) and Lane 2: NBT-II cell lysate (Wistar rat bladder tumour cells) with STK3 polyclonal antibody (Cat # PAB31384).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human breast with STK3 polyclonal antibody (Cat # PAB31384) shows strong cytoplasmic and membranous positivity in glandular cells.
Immunofluorescence
Immunofluorescent staining of A-431 cells with STK3 polyclonal antibody (Cat # PAB31384) (Green) shows localization to cytosol, rods and rings.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human STK3.
Immunogen
Recombinant protein corresponding to human STK3.
Sequence
ATSTMSEGAQTMIEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMHEPFPMSKNVFPDNWKVPQDGDFDFLKNLSLEELQMRLKALDPMMEREI
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells) and Lane 2: NBT-II cell lysate (Wistar rat bladder tumour cells) with STK3 polyclonal antibody (Cat # PAB31384).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human breast with STK3 polyclonal antibody (Cat # PAB31384) shows strong cytoplasmic and membranous positivity in glandular cells.Immunofluorescence
Immunofluorescent staining of A-431 cells with STK3 polyclonal antibody (Cat # PAB31384) (Green) shows localization to cytosol, rods and rings. -
Gene Info — STK3
Entrez GeneID
6788Protein Accession#
Q13188Gene Name
STK3
Gene Alias
FLJ90748, KRS1, MST2
Gene Description
serine/threonine kinase 3 (STE20 homolog, yeast)
Omim ID
605030Gene Ontology
HyperlinkGene Summary
Protein kinase activation is a frequent response of cells to treatment with growth factors, chemicals, heat shock, or apoptosis-inducing agents. This protein kinase activation presumably allows cells to resist unfavorable environmental conditions. The yeast 'sterile 20' (Ste20) kinase acts upstream of the mitogen-activated protein kinase (MAPK) cascade that is activated under a variety of stress conditions. MST2 was identified as a kinase that is activated by the proapoptotic agents straurosporine and FAS ligand (MIM 134638) (Taylor et al., 1996 [PubMed 8816758]; Lee et al., 2001 [PubMed 11278283]).[supplied by OMIM
Other Designations
serine/threonine kinase 3 (Ste20, yeast homolog)
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com