Product Browser

Last updated: 2018/1/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CSNK2B polyclonal antibody

  • Catalog # : PAB31372
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant human CSNK2B.
  • Immunogen:
  • Recombinant protein corresponding to human CSNK2B.
  • Sequence:
  • PHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLY
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
    Western Blot (1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot
  • Western Blot
  • Western Blot analysis of Lane 1: RT-4 cell, Lane 2: U-251 MG sp cell, Lane 3: human plasma tissue (IgG/HSA depleted), Lane 4: human liver tissue and Lane 5: human tonsil tissue lysates with CSNK2B polyclonal antibody (Cat # PAB31372).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with CSNK2B polyclonal antibody (Cat # PAB31372) shows strong nuclear and cytoplasmic positivity in cells in seminiferous ducts.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 1460
  • Gene Name:
  • CSNK2B
  • Gene Alias:
  • CK2B,CK2N,CSK2B,G5A,MGC138222,MGC138224
  • Gene Description:
  • casein kinase 2, beta polypeptide
  • Gene Summary:
  • This gene encodes the beta subunit of casein kinase II, a ubiquitous protein kinase which regulates metabolic pathways, signal transduction, transcription, translation, and replication. The enzyme is composed of three subunits, alpha, alpha prime and beta, which form a tetrameric holoenzyme. The alpha and alpha prime subunits are catalytic, while the beta subunit serves regulatory functions. The enzyme localizes to the endoplasmic reticulum and the Golgi apparatus. [provided by RefSeq
  • Other Designations:
  • Casein kinase II beta subunit,OTTHUMP00000029060,OTTHUMP00000029063,OTTHUMP00000029064,alternative name: G5a, phosvitin,phosvitin
  • RSS
  • YouTube
  • Linkedin
  • Facebook