KANK1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with KANK1 polyclonal antibody (Cat # PAB31365).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach with KANK1 polyclonal antibody (Cat # PAB31365) shows strong cytoplasmic positivity in glandular cells.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human KANK1.
Immunogen
Recombinant protein corresponding to human KANK1.
Sequence
INVCGVRKRSYSAGNASQLEQLSRARRSGGELYIDYEEEEMETVEQSTQRIKEFRQLTADMQALEQKIQDSSCEASSELRENGECRSVAVGAEENMNDIVVYHRGSRSCKDAAVGTLVEMRNCGVSVTEAMLGVMTEADKEIE
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with KANK1 polyclonal antibody (Cat # PAB31365).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach with KANK1 polyclonal antibody (Cat # PAB31365) shows strong cytoplasmic positivity in glandular cells. -
Gene Info — KANK1
Entrez GeneID
23189Protein Accession#
Q14678Gene Name
KANK1
Gene Alias
ANKRD15, DKFZp451G231, KANK, KIAA0172, MGC43128
Gene Description
KN motif and ankyrin repeat domains 1
Omim ID
607704Gene Ontology
HyperlinkGene Summary
This gene encodes a protein containing four ankyrin repeat domains in its C-terminus. The suggested role for this protein is in tumorigenesis of renal cell carcinoma. Two alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
OTTHUMP00000020957|OTTHUMP00000082438|OTTHUMP00000082439|ankyrin repeat domain 15|kidney ankyrin repeat-containing protein
-
Interactome
-
Disease
-
Publication Reference
-
Talin-KANK1 interaction controls the recruitment of cortical microtubule stabilizing complexes to focal adhesions.
Bouchet BP, Gough RE, Ammon YC, van de Willige D, Post H, Jacquemet G, Altelaar AM, Heck AJ, Goult BT, Akhmanova A.
eLife 2016 Jul; 5:e18124.
Application：IF, Human, HeLa cells.
-
KANK deficiency leads to podocyte dysfunction and nephrotic syndrome.
Gee HY, Zhang F, Ashraf S, Kohl S, Sadowski CE, Vega-Warner V, Zhou W, Lovric S, Fang H, Nettleton M, Zhu JY, Hoefele J, Weber LT, Podracka L, Boor A, Fehrenbach H, Innis JW, Washburn J, Levy S, Lifton RP, Otto EA, Han Z, Hildebrandt F.
The Journal of Clinical Investigation 2015 Jun; 125(6):2375.
Application：IF, IHC, WB-Tr, Human, Rat, Human podocytes, Rat glomeruli, Rat kidney.
-
Talin-KANK1 interaction controls the recruitment of cortical microtubule stabilizing complexes to focal adhesions.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com