ASAH1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human ASAH1.
Immunogen
Recombinant protein corresponding to human ASAH1.
Sequence
ENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLSTKPVLNKLTVYTTLIDVTKGQF
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of SK-MEL-30 cell lysate with ASAH1 polyclonal antibody (Cat # PAB31359).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human heart muscle with ASAH1 polyclonal antibody (Cat # PAB31359) shows strong granular cytoplasmic positivity in cardiomyocytes. -
Gene Info — ASAH1
Entrez GeneID
427Protein Accession#
Q13510Gene Name
ASAH1
Gene Alias
AC, ASAH, FLJ21558, FLJ22079, PHP, PHP32
Gene Description
N-acylsphingosine amidohydrolase (acid ceramidase) 1
Omim ID
228000Gene Ontology
HyperlinkGene Summary
This gene encodes a heterodimeric protein consisting of a nonglycosylated alpha subunit and a glycosylated beta subunit that is cleaved to the mature enzyme posttranslationally. The encoded protein catalyzes the synthesis and degradation of ceramide into sphingosine and fatty acid. Mutations in this gene have been associated with a lysosomal storage disorder known as Farber disease. Multiple transcript variants encoding several distinct isoforms have been identified for this gene. [provided by RefSeq
Other Designations
N-acylsphingosine amidohydrolase 1|OTTHUMP00000122482|acylsphingosine deacylase|putative 32 kDa heart protein
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Silencing diacylglycerol kinase-theta expression reduces steroid hormone biosynthesis and cholesterol metabolism in human adrenocortical cells.
Cai K, Lucki NC, Sewer MB.
Biochimica et Biophysica Acta 2014 Apr; 1841(4):552.
Application:WB-Tr, Human, H295R cells.
-
Acid ceramidase (ASAH1) represses steroidogenic factor 1-dependent gene transcription in H295R human adrenocortical cells by binding to the receptor.
Lucki NC, Li D, Bandyopadhyay S, Wang E, Merrill AH, Sewer MB.
Molecular and Cellular Biology 2012 Nov; 32(21):4419.
Application:IF, WB-Ce, Human, H295R cells.
-
Acid ceramidase (ASAH1) is a global regulator of steroidogenic capacity and adrenocortical gene expression.
Lucki NC, Bandyopadhyay S, Wang E, Merrill AH, Sewer MB.
Molecular Endocrinology (Baltimore, Md.) 2012 Feb; 26(2):228.
Application:WB-Ce, WB-Tr, Human, H295R cells.
-
Genistein stimulates MCF-7 breast cancer cell growth by inducing acid ceramidase (ASAH1) gene expression.
Lucki NC, Sewer MB.
The Journal of Biological Chemistry 2011 Jun; 286(22):19399.
Application:WB-Ce, WB-Tr, Human, MCF-7 cells.
-
The cAMP-responsive element binding protein (CREB) regulates the expression of acid ceramidase (ASAH1) in H295R human adrenocortical cells.
Lucki N, Sewer MB.
Biochimica et Biophysica Acta 2009 Aug; 1791(8):706.
Application:WB-Ce, Human, H295R cells.
-
Silencing diacylglycerol kinase-theta expression reduces steroid hormone biosynthesis and cholesterol metabolism in human adrenocortical cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com